PaperBLAST – Find papers about a protein or its homologs

 

Align NP_573063.1 to PF02582 (DUF155)

NP_573063.1 has 420 amino acids

Query:       DUF155  [M=176]
Accession:   PF02582.14
Description: Uncharacterised ACR, YagE family COG1723
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.1e-51  161.5   0.3    1.7e-51  160.9   0.3    1.3  1  NP_573063.1  


Domain annotation for each sequence (and alignments):
>> NP_573063.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  160.9   0.3   1.7e-51   1.7e-51       1     176 []     158     352 ..     158     352 .. 0.89

  Alignments for each domain:
  == domain 1  score: 160.9 bits;  conditional E-value: 1.7e-51
       DUF155   1 vfiFknGsvVfwgldeeeeknflnkllkflneeselpreeeqeteeleyvydeq..................sessrikgdvivlksk..slleklai 78 
                  +f+F+ GsvVfw++++ e +n+l+ +l+++++es+++   + e+e + y+y ++                  +++  ++++++ ++ +  s l k+++
  NP_573063.1 158 IFFFREGSVVFWNCSDIETNNVLS-FLRAFERESYVSALVHGESEVMPYTYIPStavdvegdlvaessdfnvTSRAFFQNGKFFVTADtdSFLYKYTF 254
                  7************99999999999.555667778999999999*********97777777777766666666444556666666633356******** PP

       DUF155  79 ShalaqSvkLdvlEesldellestekipkelakkgklklsrkellkktgellslrinlnlkselldtPdffWeepeleslyeavseyleikeRikiLn 176
                  S+a+aqS+kL ++E+ ld++++s+e+++++l+++ +l++sr ++l+ktgel+ lr+ +nl+s+lld Pdf+W+++ele ly +v++y+ i++R+k++n
  NP_573063.1 255 SNAMAQSIKLGMWEATLDRYIDSIEHLTEDLKRGRRLRISRAAMLRKTGELFALRHVINLSSDLLDAPDFYWDREELEALYLQVCSYFSISRRTKVMN 352
                  ************************************************************************************************99 PP



Or compare NP_573063.1 to CDD or PaperBLAST