PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::O74446 to PF02582 (DUF155)

SwissProt::O74446 has 382 amino acids

Query:       DUF155  [M=176]
Accession:   PF02582.14
Description: Uncharacterised ACR, YagE family COG1723
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    4.7e-53  166.0   0.5    7.4e-53  165.4   0.5    1.3  1  SwissProt::O74446  


Domain annotation for each sequence (and alignments):
>> SwissProt::O74446  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  165.4   0.5   7.4e-53   7.4e-53       1     176 []     158     330 ..     158     330 .. 0.96

  Alignments for each domain:
  == domain 1  score: 165.4 bits;  conditional E-value: 7.4e-53
             DUF155   1 vfiFknGsvVfwgldeeeeknflnkllkflneeselpreeeqeteeleyvydeqsessrikgdvivl.kskslleklaiShalaqSvkLdvl 91 
                        vf F +G+vV+wg + +ee +fl++l +f  e+    + e +e ee++y++++  +++ri +d i l + ++ + +l+iSha+aqSvk++++
  SwissProt::O74446 158 VFCFTYGVVVLWGYTIDEEHRFLRELGRFEIEK---LKIEDMEVEEFNYYITT-LYQPRIFNDFIALrDASNYMIRLSISHAIAQSVKISLF 245
                        89***************************7765...677777799****9877.999**********77779******************** PP

             DUF155  92 EesldellestekipkelakkgklklsrkellkktgellslrinlnlkselldtPdffWeepeleslyeavseyleikeRikiLn 176
                        Ee+++e+++ t+++p+++a++g+++l+r+e++  +g+l+ lrin+nl+ ++ld+P+++W ep+le++y+a ++ylei++R+ +Ln
  SwissProt::O74446 246 EELVNETIDATKDTPQMIAETGRVNLKREEIMMAVGQLFILRININLQGSVLDSPELMWTEPQLEPIYTAARSYLEINQRVALLN 330
                        ************************************************************************************9 PP



Or compare SwissProt::O74446 to CDD or PaperBLAST