PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q9NWS8 to PF02582 (DUF155)

SwissProt::Q9NWS8 has 449 amino acids

Query:       DUF155  [M=176]
Accession:   PF02582.14
Description: Uncharacterised ACR, YagE family COG1723
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
      3e-50  156.9   0.8    4.4e-50  156.3   0.8    1.3  1  SwissProt::Q9NWS8  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q9NWS8  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  156.3   0.8   4.4e-50   4.4e-50       1     176 []     226     403 ..     226     403 .. 0.93

  Alignments for each domain:
  == domain 1  score: 156.3 bits;  conditional E-value: 4.4e-50
             DUF155   1 vfiFknGsvVfwgldeeeeknflnkllkflneeselpreeeqeteeleyvydeqsessrikgdvivlksk.....slleklaiShalaqSvk 87 
                        +f+F+ G+ Vfw+++++  k +++ l+k+  +++ +    + e+eel+y++ e   +s+++ + i l+s+      +lek+a+S+al  Svk
  SwissProt::Q9NWS8 226 IFFFREGAAVFWNVKDKTMKHVMKVLEKHEIQPY-EIALVHWENEELNYIKIE--GQSKLHRGEIKLNSEldlddAILEKFAFSNALCLSVK 314
                        7************999999999887777766665.555555559*****9987..6689********9999********************* PP

             DUF155  88 LdvlEesldellestekipkelakkgklklsrkellkktgellslrinlnlkselldtPdffWeepeleslyeavseyleikeRikiLn 176
                        L+++E+sld+++es+++ip++l+ ++k+kls++e+++k+gel+ lr+++nl+s++l tPdf+W++++le+ly+++++ l i++R+k++n
  SwissProt::Q9NWS8 315 LAIWEASLDKFIESIQSIPEALKAGKKVKLSHEEVMQKIGELFALRHRINLSSDFLITPDFYWDRENLEGLYDKTCQFLSIGRRVKVMN 403
                        **************************9*************************************************************9 PP



Or compare SwissProt::Q9NWS8 to CDD or PaperBLAST