PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6581569 to PF02582 (DUF155)

VIMSS6581569 has 430 amino acids

Query:       DUF155  [M=176]
Accession:   PF02582.14
Description: Uncharacterised ACR, YagE family COG1723
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.2e-60  190.8   1.7    1.8e-60  190.2   1.7    1.3  1  VIMSS6581569  


Domain annotation for each sequence (and alignments):
>> VIMSS6581569  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  190.2   1.7   1.8e-60   1.8e-60       1     176 []     205     377 ..     205     377 .. 0.95

  Alignments for each domain:
  == domain 1  score: 190.2 bits;  conditional E-value: 1.8e-60
        DUF155   1 vfiFknGsvVfwgldeeeeknflnkllkflneeselpreeeqeteeleyvydeqsessrikgdvivl.kskslleklaiShalaqSvkLdvlEesld 96 
                   +fiF++G+vV+wg++e+eek+fln+++kf +e+  l +e++q  ee++y+ ++ s+++ri++d i+l + ++ + kl+iSha+aqSvk++++Ee++d
  VIMSS6581569 205 LFIFEYGVVVMWGFTEREEKAFLNDIEKFEKEK--LAEEDIQ-VEEFNYYVTK-SYQPRIYNDFITLrDGSNYMVKLSISHAIAQSVKISLFEELVD 297
                   6****************************7776..5666666.8999998876.999**********77779************************* PP

        DUF155  97 ellestekipkelakkgklklsrkellkktgellslrinlnlkselldtPdffWeepeleslyeavseyleikeRikiLn 176
                   +++e t++ip+e+a +gk+++s+++++k++gel+ lrin+nl+ ++ld+P+++W+ep+le++y+a++ ylei++R+ +Ln
  VIMSS6581569 298 NTIEDTQDIPQEIAYSGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWSEPQLEPIYQATRGYLEINQRVSLLN 377
                   *******************************************************************************9 PP



Or compare VIMSS6581569 to CDD or PaperBLAST