PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6581860 to PF02582 (DUF155)

VIMSS6581860 has 414 amino acids

Query:       DUF155  [M=176]
Accession:   PF02582.14
Description: Uncharacterised ACR, YagE family COG1723
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    3.5e-50  156.7   0.0    6.1e-50  155.9   0.0    1.4  1  VIMSS6581860  


Domain annotation for each sequence (and alignments):
>> VIMSS6581860  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  155.9   0.0   6.1e-50   6.1e-50       4     176 .]     158     350 ..     154     350 .. 0.90

  Alignments for each domain:
  == domain 1  score: 155.9 bits;  conditional E-value: 6.1e-50
        DUF155   4 FknGsvVfwgldeeeeknflnkllkflneeselpreeeqeteeleyvydeq..................sessrikgdvivlksk....slleklai 78 
                    +nGs+V+wg++e+ ++n++  ++k+++ +  + + e  ete+++yv+ e                     +s ++gd i+++s      +l+k a+
  VIMSS6581860 158 GQNGSIVSWGFSESSVRNCIVPIVKAASLN--PLNGEDFETEDMDYVEIEGeqdfdklssldnkvtpriACESFLSGDLIIINSLdsdqGMLDKAAF 252
                   58**********************997776..888888899******988766666666666666655544455********76669999******* PP

        DUF155  79 ShalaqSvkLdvlEesldellestekipkelakkgklklsrkellkktgellslrinlnlkselldtPdffWeepeleslyeavseyleikeRikiL 175
                   S++l++S+ L+vlEe++++++++t++i+++++k+ kl+l++++ lk++g+l+ +r +lnl+sel++tPd++W+ep+le+++++vs+yl+i++Ri+iL
  VIMSS6581860 253 SSGLSRSTNLAVLEEAMEKHISKTRTITENISKGTKLNLRSSDALKSIGRLFLIRGKLNLYSELIETPDLYWSEPQLEEIFKNVSRYLDIGPRINIL 349
                   ************************************************************************************************* PP

        DUF155 176 n 176
                   n
  VIMSS6581860 350 N 350
                   9 PP



Or compare VIMSS6581860 to CDD or PaperBLAST