PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6630801 to PF02582 (DUF155)

VIMSS6630801 has 636 amino acids

Query:       DUF155  [M=176]
Accession:   PF02582.14
Description: Uncharacterised ACR, YagE family COG1723
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.2e-53  167.9   0.0    1.7e-53  167.4   0.0    1.2  1  VIMSS6630801  


Domain annotation for each sequence (and alignments):
>> VIMSS6630801  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  167.4   0.0   1.7e-53   1.7e-53       2     176 .]     386     559 ..     385     559 .. 0.97

  Alignments for each domain:
  == domain 1  score: 167.4 bits;  conditional E-value: 1.7e-53
        DUF155   2 fiFknGsvVfwgldeeeeknflnkllkflneeselpreeeqeteeleyvydeqsessrikgdvivlkskslleklaiShalaqSvkLdvlEesldel 98 
                   ++F++G+ Vf+g++e eek+++++ + + +    l +++++  ee++yv+d++ e++ri++d+++ ks+s+l kl+++ha+aqS+kL+++E+ ++e+
  VIMSS6630801 386 IFFSYGVSVFFGFNEGEEKEIMEDAETAGAWTRGLGEDDWE-IEEFHYVHDPDAENPRIYNDMFTFKSRSHLFKLSLAHAIAQSTKLSIYESVMQET 481
                   58***********************9998888777777777.9****************************************************** PP

        DUF155  99 lestekipkelakkgklklsrkellkktgellslrinlnlkselldtPdffWeepeleslyeavseyleikeRikiLn 176
                   l+ t ++pkel+ +g+l+l+r+e lk tg+l++lr+++nl+  +ldtP++fW+e++l +lyeav+eylei++Ri++Ln
  VIMSS6630801 482 LSLTASFPKELSITGHLQLTRREALKMTGRLFKLRMDVNLSGGILDTPELFWSEASLFPLYEAVHEYLEIGPRIQVLN 559
                   *****************************************************************************9 PP



Or compare VIMSS6630801 to CDD or PaperBLAST