PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS756572 to PF02582 (DUF155)

VIMSS756572 has 268 amino acids

Query:       DUF155  [M=176]
Accession:   PF02582.14
Description: Uncharacterised ACR, YagE family COG1723
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    5.5e-43  133.2   0.4    1.6e-42  131.7   0.1    1.7  2  VIMSS756572  


Domain annotation for each sequence (and alignments):
>> VIMSS756572  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.8   0.0     0.079     0.079      77     105 ..       3      31 ..       1      35 [. 0.85
   2 !  131.7   0.1   1.6e-42   1.6e-42       1     176 []      49     222 ..      49     222 .. 0.92

  Alignments for each domain:
  == domain 1  score: -0.8 bits;  conditional E-value: 0.079
       DUF155  77 aiShalaqSvkLdvlEesldellesteki 105
                  ++S+  a+++ L  l  +l+++ ++++ +
  VIMSS756572   3 CLSFCVAKTIDLTRLDLHLKNVSKEFSAV 31 
                  789999*******9999999999988876 PP

  == domain 2  score: 131.7 bits;  conditional E-value: 1.6e-42
       DUF155   1 vfiFknGsvVfwgldeeeeknflnkllkflneeselpreeeqeteeleyvydeq...sessrikgdvivlkskslleklaiShalaqSvkLdvlEesl 95 
                  +fiFknG+vV+wg+++ +  ++l+ ++  ++++     ++   ++e++y ++++   +++     d ++++++s + kl++S++++qSvkL+++E+ +
  VIMSS756572  49 LFIFKNGTVVSWGVKRYQIHEYLDIIKLLVDKP-----VALLVHDEFHYQIGDKtaiEPHGFYDVDCLTIEEDSDELKLSLSYGFSQSVKLQYFETII 141
                  6***************99999999666664443.....33334799***9999877766677889********************************* PP

       DUF155  96 dellestekipkelakkgklklsrkellkktgellslrinlnlkselldtPdffWeepeleslyeavseyleikeRikiLn 176
                  d+l+e+ +++ ++l++kg++++srk++ + +ge+l  + +lnl s++l +P +fW++p+le+++ ++++yl i++R++++n
  VIMSS756572 142 DALIEKYNPLIQALSHKGEMPISRKQIQQVIGEILGAKSELNLISNFLYHPKYFWQHPTLEEHFSMLERYLHIQRRVNAIN 222
                  ******************************************************************************998 PP



Or compare VIMSS756572 to CDD or PaperBLAST