PaperBLAST – Find papers about a protein or its homologs

 

Align XP_005267097.1 to PF02582 (DUF155)

XP_005267097.1 has 238 amino acids

Query:       DUF155  [M=176]
Accession:   PF02582.14
Description: Uncharacterised ACR, YagE family COG1723
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    6.6e-51  159.0   0.8      8e-51  158.8   0.8    1.1  1  XP_005267097.1  


Domain annotation for each sequence (and alignments):
>> XP_005267097.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  158.8   0.8     8e-51     8e-51       1     176 []      15     192 ..      15     192 .. 0.93

  Alignments for each domain:
  == domain 1  score: 158.8 bits;  conditional E-value: 8e-51
          DUF155   1 vfiFknGsvVfwgldeeeeknflnkllkflneeselpreeeqeteeleyvydeqsessrikgdvivlksk.....slleklaiShalaqSvkLdv 90 
                     +f+F+ G+ Vfw+++++  k +++ l+k+  +++ +    + e+eel+y++ e   +s+++ + i l+s+      +lek+a+S+al  SvkL++
  XP_005267097.1  15 IFFFREGAAVFWNVKDKTMKHVMKVLEKHEIQPY-EIALVHWENEELNYIKIE--GQSKLHRGEIKLNSEldlddAILEKFAFSNALCLSVKLAI 106
                     7************999999999887777766665.555555559*****9987..6689********9999************************ PP

          DUF155  91 lEesldellestekipkelakkgklklsrkellkktgellslrinlnlkselldtPdffWeepeleslyeavseyleikeRikiLn 176
                     +E+sld+++es+++ip++l+ ++k+kls++e+++k+gel+ lr+++nl+s++l tPdf+W++++le+ly+++++ l i++R+k++n
  XP_005267097.1 107 WEASLDKFIESIQSIPEALKAGKKVKLSHEEVMQKIGELFALRHRINLSSDFLITPDFYWDRENLEGLYDKTCQFLSIGRRVKVMN 192
                     ***********************9*************************************************************9 PP



Or compare XP_005267097.1 to CDD or PaperBLAST