PaperBLAST – Find papers about a protein or its homologs

 

Align XP_006227896.1 to PF02582 (DUF155)

XP_006227896.1 has 450 amino acids

Query:       DUF155  [M=176]
Accession:   PF02582.14
Description: Uncharacterised ACR, YagE family COG1723
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.1e-51  161.6   1.4    1.6e-51  161.1   1.4    1.3  1  XP_006227896.1  


Domain annotation for each sequence (and alignments):
>> XP_006227896.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  161.1   1.4   1.6e-51   1.6e-51       1     176 []     227     404 ..     227     404 .. 0.95

  Alignments for each domain:
  == domain 1  score: 161.1 bits;  conditional E-value: 1.6e-51
          DUF155   1 vfiFknGsvVfwgldeeeeknflnkllkflneeselpreeeqeteeleyvydeqsessrikgdvivlksk.....slleklaiShalaqSvkLdv 90 
                     +f+F+ G+ Vfw+++++  k +++ l+++ ++++e+  + ++ +eel+y+++e   +s+++ + i l+s+     s+lek+a+S+al  SvkL++
  XP_006227896.1 227 IFLFREGAAVFWNVKDKTMKHVMQVLERHETQPYEVALVHWE-NEELNYTKTE--GQSKLHRGEIKLNSEldlddSILEKFAFSNALCLSVKLAI 318
                     7**************999999999888888887666666666.9*****9876..679*********9999************************ PP

          DUF155  91 lEesldellestekipkelakkgklklsrkellkktgellslrinlnlkselldtPdffWeepeleslyeavseyleikeRikiLn 176
                     +E+ ld+++es+++ip++l+ ++k+kls+ke+++k+gel+ lr+++nl+s++l tPdf+W++++le+ly+++++ l i++R+k++n
  XP_006227896.1 319 WEATLDKFIESIQSIPEALKAGKKVKLSHKEVMQKMGELFALRHRINLSSDFLITPDFYWDRANLEELYDKTCQFLSITRRVKVMN 404
                     ***********************9*************************************************************9 PP



Or compare XP_006227896.1 to CDD or PaperBLAST