PaperBLAST – Find papers about a protein or its homologs

 

Align D5E990 to PF02594 (DUF167)

D5E990 has 103 amino acids

Query:       DUF167  [M=76]
Accession:   PF02594.20
Description: Uncharacterised ACR, YggU family COG1872
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.1e-21   63.1   0.0    1.3e-21   62.8   0.0    1.1  1  D5E990    


Domain annotation for each sequence (and alignments):
>> D5E990  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   62.8   0.0   1.3e-21   1.3e-21       1      75 [.      13      87 ..      13      88 .. 0.96

  Alignments for each domain:
  == domain 1  score: 62.8 bits;  conditional E-value: 1.3e-21
  DUF167  1 gvllavrvkPgakkdaigeeeaegrealkvrvaappvdGkANaaliefLakalgvpksdveivsGetsreKvvri 75
            g++++ +++Pg++k  ++ +++++r++++ ++++ +++GkAN++li+ L+++++++ s+++iv+G++  +K v++
  D5E990 13 GCIIDFEINPGSSKLVVPSGYNIWRKRVEGKLTESAQKGKANDQLIQRLSHIFQINSSSITIVAGAKTTKKSVHL 87
            5799**************88****************************************************986 PP



Or compare D5E990 to CDD or PaperBLAST