XP_002448812.1 has 131 amino acids
Query: DUF167 [M=76]
Accession: PF02594.20
Description: Uncharacterised ACR, YggU family COG1872
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.4e-27 81.2 0.9 3.6e-27 80.7 0.9 1.3 1 XP_002448812.1
Domain annotation for each sequence (and alignments):
>> XP_002448812.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 80.7 0.9 3.6e-27 3.6e-27 2 76 .] 42 113 .. 41 113 .. 0.97
Alignments for each domain:
== domain 1 score: 80.7 bits; conditional E-value: 3.6e-27
DUF167 2 vllavrvkPgakkdaigeeeaegrealkvrvaappvdGkANaaliefLakalgvpksdveivsGetsreKvvrie 76
v +++++kPg+k i+ ++g+ea+ v++ ap++dG+ANaal++f++ +lgv+k++v+i sG++sreKvv+++
XP_002448812.1 42 VAISIHAKPGSKVATIT---EIGDEAVGVQIDAPARDGEANAALVDFISSVLGVKKREVSIGSGSKSREKVVLVQ 113
78***************...8999************************************************985 PP
Or compare XP_002448812.1 to CDD or PaperBLAST