PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1141120 to PF02622 (DUF179)

VIMSS1141120 has 184 amino acids

Query:       DUF179  [M=160]
Accession:   PF02622.15
Description: Uncharacterized ACR, COG1678
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
      2e-49  153.8   0.0    2.2e-49  153.7   0.0    1.0  1  VIMSS1141120  


Domain annotation for each sequence (and alignments):
>> VIMSS1141120  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  153.7   0.0   2.2e-49   2.2e-49       1     160 []      12     171 ..      12     171 .. 0.93

  Alignments for each domain:
  == domain 1  score: 153.7 bits;  conditional E-value: 2.2e-49
                   TTSTTTTSTTEEEEEEEEETTEEEEEESSSEE.EEEHHHHHHHGCTSSSST-CHHHSEEEES-SEEEEEEEEEEES....SSSEEECSTTEEEE-SS CS
        DUF179   1 psledpnFersVvlllehdeegalGlvlNrpl.eltlkelleelleleaepateklssvylGGPveqdrlfvlhsle..elessleisdglylttsl 94 
                   ps+ dp+Fers vl+++h+ +ga+Glv+N+p+ +l+++ +le+ l++  +p+ +   +v+lGGP+e+ r+fvlhs +  ++ +++ +s ++ +t+++
  VIMSS1141120  12 PSMADPRFERSLVLICAHSPDGAMGLVVNKPVeDLSFAGMLEQ-LNIPRAPNGR-DIRVHLGGPMERGRGFVLHSPDymSVGATMLVSGKFGMTATV 106
                   89*****************99***********999*******9.6666666664.479*****************5566889999************ PP

                   HHHHHHCSTTSCSSEEEEEEEEEECTTHHHHHHHTTSEEEEE-.HHHHHCTSTSSHHHHHHHHCCT CS
        DUF179  95 dilealagkagpeklrvflGyagWeagQLeeEieegaWlvvpassedllfetppeelWeealrrlG 160
                   dileala+++gp+  +++lGy+gW++gQLe+E+++++Wl+++a +++l+f++++  +W  +lr++G
  VIMSS1141120 107 DILEALARGQGPSSALMALGYSGWGPGQLEAEVQRNDWLTAEA-PSELVFSDDDPGKWTGMLRHMG 171
                   *******************************************.555*****************98 PP



Or compare VIMSS1141120 to CDD or PaperBLAST