PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS123592 to PF02622 (DUF179)

VIMSS123592 has 201 amino acids

Query:       DUF179  [M=160]
Accession:   PF02622.15
Description: Uncharacterized ACR, COG1678
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.4e-50  156.8   0.0    2.8e-50  156.6   0.0    1.0  1  VIMSS123592  


Domain annotation for each sequence (and alignments):
>> VIMSS123592  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  156.6   0.0   2.8e-50   2.8e-50       1     160 []      24     188 ..      24     188 .. 0.92

  Alignments for each domain:
  == domain 1  score: 156.6 bits;  conditional E-value: 2.8e-50
                  TTSTTTTSTTEEEEEEEEETTEEEEEESSSEEEEEHHHHHHHGCTSSSST-CHHH......SEEEES-SEEEEEEEEEEES...SSSEEECSTTEEEE CS
       DUF179   1 psledpnFersVvlllehdeegalGlvlNrpleltlkelleelleleaepatekl......ssvylGGPveqdrlfvlhsle.elessleisdglylt 91 
                  p++ d+nF+r+V+++++h+e+ga+G++lNrp +lt+ ++l +l+ l+ ++++ +l       ++  GGPve+ r+fvlhs +   +ss+++sd+++lt
  VIMSS123592  24 PGMFDTNFARTVIFVCAHSEDGAMGFILNRPQRLTFPDVLLHLQLLD-PDEAIRLpsatreFQIQAGGPVETGRGFVLHSDDyLSDSSIPVSDDICLT 120
                  7899************************************9955555.44443447899999******************7777889*********** PP

                  -SSHHHHHHCSTTSCSSEEEEEEEEEECTTHHHHHHHTTSEEEEE-.HHHHHCTSTSSHHHHHHHHCCT CS
       DUF179  92 tsldilealagkagpeklrvflGyagWeagQLeeEieegaWlvvpassedllfetppeelWeealrrlG 160
                  ++ldi++a+++++gp k  ++lGyagW++gQLe+Ei ++ Wl++pa++e l+f+ + +e++++al+++G
  VIMSS123592 121 ATLDIVRAISRGEGPLKATMLLGYAGWGPGQLEAEITQNGWLTCPAQEE-LIFSRDLDEKYDRALALMG 188
                  **********************************************555.****************998 PP



Or compare VIMSS123592 to CDD or PaperBLAST