PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1244737 to PF02622 (DUF179)

VIMSS1244737 has 194 amino acids

Query:       DUF179  [M=160]
Accession:   PF02622.15
Description: Uncharacterized ACR, COG1678
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.6e-44  137.8   0.0    1.9e-44  137.6   0.0    1.0  1  VIMSS1244737  


Domain annotation for each sequence (and alignments):
>> VIMSS1244737  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  137.6   0.0   1.9e-44   1.9e-44       3     160 .]      16     177 ..      14     177 .. 0.92

  Alignments for each domain:
  == domain 1  score: 137.6 bits;  conditional E-value: 1.9e-44
                   STTTT.STTEEEEEEEEETTEEEEEESSSEEEEEHHHHHHHGCTSSSST-CHHH..SEEEES-SEEEEEEEEEEES....SSSEEECSTTEEEE-SS CS
        DUF179   3 ledpn.FersVvlllehdeegalGlvlNrpleltlkelleelleleaepatekl..ssvylGGPveqdrlfvlhsle..elessleisdglylttsl 94 
                   ++d+  F +sVv+l+++d++ga+Gl++N+pl  tlk+++ee l++ ++++ +++   ++y+GGP++++++++lh+++  + +s++++++gl++t+s 
  VIMSS1244737  16 IKDDIvFTKSVVYLCQNDRHGAMGLIINKPLADTLKDVFEE-LHIPHTNTFKEIleYPLYMGGPISPHKIMILHTTNgrNYTSTIKLDEGLAITASI 111
                   556655************99***********99*******9.56665655655589*******************7777999*************** PP

                   HHHHHHCSTTSCSSEEEEEEEEEECTTHHHHHHHTTSEEEEE-.HHHHHCTSTSSHHHHHHHHCCT CS
        DUF179  95 dilealagkagpeklrvflGyagWeagQLeeEieegaWlvvpassedllfetppeelWeealrrlG 160
                   dile++a++  pe ++ ++Gy+ W+a+QL +Ei++++W+v++  ++++lf+++++ +W++ l+++G
  VIMSS1244737 112 DILEDIANNILPEYFLPVVGYSCWTANQLTDEIKSNDWIVTNKLNKKILFNHENKVKWQNHLEHAG 177
                   *************************************************************99987 PP



Or compare VIMSS1244737 to CDD or PaperBLAST