PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS140417 to PF02622 (DUF179)

VIMSS140417 has 182 amino acids

Query:       DUF179  [M=160]
Accession:   PF02622.15
Description: Uncharacterized ACR, COG1678
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.1e-47  148.1   0.0    1.3e-47  147.9   0.0    1.0  1  VIMSS140417  


Domain annotation for each sequence (and alignments):
>> VIMSS140417  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  147.9   0.0   1.3e-47   1.3e-47       1     160 []      12     169 ..      12     169 .. 0.93

  Alignments for each domain:
  == domain 1  score: 147.9 bits;  conditional E-value: 1.3e-47
                  TTSTTTTSTTEEEEEEEEETTEEEEEESSSEEEEEHHHHHHHGCTSSSST-CHHHSEEEES-SEEEEEEEEEEES...SSSEEECSTTEEEE-SSHHH CS
       DUF179   1 psledpnFersVvlllehdeegalGlvlNrpleltlkelleelleleaepateklssvylGGPveqdrlfvlhsle.elessleisdglylttsldil 97 
                  p++ed  F++sVv++++hde+galG+ +N+p+ +t++ ++++ +  + + ++ + +sv++GGPv+ +r++v+h+   +++ss+ +sd+++lt+s+d++
  VIMSS140417  12 PDMEDAFFSQSVVYICKHDEDGALGIAINKPSPITMDMIFSA-TGKNIPMRM-QHDSVMMGGPVQVERGYVVHTPIgNWQSSIGVSDNIALTSSRDVI 107
                  89**************************************98.666666555.569******************44689******************* PP

                  HHHCSTTSCSSEEEEEEEEEECTTHHHHHHHTTSEEEEE-.HHHHHCTSTSSHHHHHHHHCCT CS
       DUF179  98 ealagkagpeklrvflGyagWeagQLeeEieegaWlvvpassedllfetppeelWeealrrlG 160
                  e+++++   +k ++ +Gy++W++gQLe+E++++aWl+vpa +e++lf+ p e+++++a+++lG
  VIMSS140417 108 ENISREGAVDKALISIGYSSWSKGQLERELADNAWLTVPA-DEHILFDIPYEHRYAAAFAKLG 169
                  ***99***********************************.555**************99987 PP



Or compare VIMSS140417 to CDD or PaperBLAST