PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS150393 to PF02622 (DUF179)

VIMSS150393 has 187 amino acids

Query:       DUF179  [M=160]
Accession:   PF02622.15
Description: Uncharacterized ACR, COG1678
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.4e-52  164.1   0.0    1.6e-52  163.9   0.0    1.0  1  VIMSS150393  


Domain annotation for each sequence (and alignments):
>> VIMSS150393  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  163.9   0.0   1.6e-52   1.6e-52       1     160 []      12     174 ..      12     174 .. 0.94

  Alignments for each domain:
  == domain 1  score: 163.9 bits;  conditional E-value: 1.6e-52
                  TTSTTTTSTTEEEEEEEEETTEEEEEESSSEE.EEEHHHHHHHGCTSSSST-CHHH...SEEEES-SEEEEEEEEEEES...SSSEEECSTTEEEE-S CS
       DUF179   1 psledpnFersVvlllehdeegalGlvlNrpl.eltlkelleelleleaepatekl...ssvylGGPveqdrlfvlhsle.elessleisdglyltts 93 
                  p+l+dp F+rsVv+++eh+++ga+G+++N+pl +l+++ +le+ l+++ ep+ +++   + v+lGGP+++dr+f+lh+ + + +ss++isd++++tts
  VIMSS150393  12 PALQDPIFRRSVVYICEHNQDGAMGIIVNKPLeNLQIEGILEK-LKITPEPRDSAIrldKAVMLGGPLAEDRGFILHTPPsRFASSIRISDNTVITTS 108
                  89******************************889*******9.667667777666899*******************557899************** PP

                  SHHHHHHCSTTSCSSEEEEEEEEEECTTHHHHHHHTTSEEEEE-.HHHHHCTSTSSHHHHHHHHCCT CS
       DUF179  94 ldilealagkagpeklrvflGyagWeagQLeeEieegaWlvvpassedllfetppeelWeealrrlG 160
                  +d+le+l ++++p++++v+lGya+W++gQLe+E+ ++aWl++pa+ + +lf+tp +e+W+ea +++G
  VIMSS150393 109 RDVLETLGTQQQPSDVLVALGYASWDKGQLEQELLDNAWLTAPADLN-ILFKTPIAERWREAAKLIG 174
                  *******99***********************************666.**************99987 PP



Or compare VIMSS150393 to CDD or PaperBLAST