PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS17027 to PF02622 (DUF179)

VIMSS17027 has 187 amino acids

Query:       DUF179  [M=160]
Accession:   PF02622.15
Description: Uncharacterized ACR, COG1678
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    7.1e-54  168.3   0.0      8e-54  168.1   0.0    1.0  1  VIMSS17027  


Domain annotation for each sequence (and alignments):
>> VIMSS17027  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  168.1   0.0     8e-54     8e-54       1     160 []      12     174 ..      12     174 .. 0.94

  Alignments for each domain:
  == domain 1  score: 168.1 bits;  conditional E-value: 8e-54
                 TTSTTTTSTTEEEEEEEEETTEEEEEESSSEE.EEEHHHHHHHGCTSSSST-CHHH...SEEEES-SEEEEEEEEEEES...SSSEEECSTTEEEE-SS CS
      DUF179   1 psledpnFersVvlllehdeegalGlvlNrpl.eltlkelleelleleaepatekl...ssvylGGPveqdrlfvlhsle.elessleisdglylttsl 94 
                 p+l+dp F+rsVv+++eh+++ga+G+++N+pl +l+++ +le+ l+++ ep+ e++   ++v+lGGP+++dr+f+lh+ + + +ss++isd++++tts+
  VIMSS17027  12 PALQDPIFRRSVVYICEHNTNGAMGIIVNKPLeNLKIEGILEK-LKITPEPRDESIrldKPVMLGGPLAEDRGFILHTPPsNFASSIRISDNTVMTTSR 109
                 89******************************899*******9.667667777666899*******************557999*************** PP

                 HHHHHHCSTTSCSSEEEEEEEEEECTTHHHHHHHTTSEEEEE-.HHHHHCTSTSSHHHHHHHHCCT CS
      DUF179  95 dilealagkagpeklrvflGyagWeagQLeeEieegaWlvvpassedllfetppeelWeealrrlG 160
                 d+le+l ++++p++++v+lGya+We+gQLe+Ei ++aWl++pa+ + +lf+tp +++W+ea +++G
  VIMSS17027 110 DVLETLGTDKQPSDVLVALGYASWEKGQLEQEILDNAWLTAPADLN-ILFKTPIADRWREAAKLIG 174
                 ******99***********************************666.**************99987 PP



Or compare VIMSS17027 to CDD or PaperBLAST