PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS326034 to PF02622 (DUF179)

VIMSS326034 has 188 amino acids

Query:       DUF179  [M=160]
Accession:   PF02622.15
Description: Uncharacterized ACR, COG1678
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      2e-50  157.1   0.0    2.2e-50  156.9   0.0    1.0  1  VIMSS326034  


Domain annotation for each sequence (and alignments):
>> VIMSS326034  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  156.9   0.0   2.2e-50   2.2e-50       1     160 []      17     175 ..      17     175 .. 0.96

  Alignments for each domain:
  == domain 1  score: 156.9 bits;  conditional E-value: 2.2e-50
                  TTSTTTTSTTEEEEEEEEETTEEEEEESSSEEEEEHHHHHHHGCTSSSST-CHHHSEEEES-SEEEEEEEEEEES...SSSEEECSTTEEEE-SSHHH CS
       DUF179   1 psledpnFersVvlllehdeegalGlvlNrpleltlkelleelleleaepateklssvylGGPveqdrlfvlhsle.elessleisdglylttsldil 97 
                  ps+ dp+F+r V l+++hd++ga+G+vlNrp+e+tl+e+l + + +e++++t +++ v+ GGPv++dr+fv+  +e  +  sl i dglyltts+d+l
  VIMSS326034  17 PSMPDPHFARGVALICQHDSNGAMGVVLNRPSEYTLGEVLFQ-MGIETASETLREQVVLAGGPVHPDRGFVIYDSEhVWGPSLLIGDGLYLTTSRDVL 113
                  89***************************************9.889999999999******************966667889**************** PP

                  HHHCSTTSCSSEEEEEEEEEECTTHHHHHHHTTSEEEEE-.HHHHHCTSTSSHHHHHHHHCCT CS
       DUF179  98 ealagkagpeklrvflGyagWeagQLeeEieegaWlvvpassedllfetppeelWeealrrlG 160
                  +a+a+++gp++ +v+lG+agW+agQLe E+ e+ Wl+vpa+++ llf+t+ e++W++a  r+G
  VIMSS326034 114 AAMAEGSGPSRALVALGCAGWAAGQLELELVENNWLMVPADAS-LLFDTALEQRWQRAAGRIG 175
                  ****************************************666.**************99987 PP



Or compare VIMSS326034 to CDD or PaperBLAST