PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS511614 to PF02622 (DUF179)

VIMSS511614 has 201 amino acids

Query:       DUF179  [M=160]
Accession:   PF02622.15
Description: Uncharacterized ACR, COG1678
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.1e-48  151.3   0.0    1.3e-48  151.1   0.0    1.0  1  VIMSS511614  


Domain annotation for each sequence (and alignments):
>> VIMSS511614  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  151.1   0.0   1.3e-48   1.3e-48       1     160 []      31     188 ..      31     188 .. 0.91

  Alignments for each domain:
  == domain 1  score: 151.1 bits;  conditional E-value: 1.3e-48
                  TTSTTTTSTTEEEEEEEEETTEEEEEESSSEEEEEHHHHHHHGCTSSSST-CHHHSEEEES-SEEEEEEEEEEES...SSSEEECSTTEEEE-SSHHH CS
       DUF179   1 psledpnFersVvlllehdeegalGlvlNrpleltlkelleelleleaepateklssvylGGPveqdrlfvlhsle.elessleisdglylttsldil 97 
                  p++ +++++ +V++++eh+++galGlv+Nrp++ltl++l+e+ ++l+ e    k + v++GGPv++dr+fvlh  + + +ss+++  +l+ltts+d+l
  VIMSS511614  31 PGVVEGSLAGTVIYICEHTRRGALGLVINRPTDLTLATLFER-IDLKLEIGPVKDEMVFFGGPVQTDRGFVLHAPAgDYTSSINLG-ELALTTSRDVL 126
                  5667889999*******************************9.66776666667799*****************545677777776.9********** PP

                  HHHCSTTSCSSEEEEEEEEEECTTHHHHHHHTTSEEEEE-.HHHHHCTSTSSHHHHHHHHCCT CS
       DUF179  98 ealagkagpeklrvflGyagWeagQLeeEieegaWlvvpassedllfetppeelWeealrrlG 160
                  +a+a+++gp++++v+lGyagW+agQLe+E+++++Wl v a+s+ ++f+ +pe+++ +al++lG
  VIMSS511614 127 QAVADGNGPARMLVTLGYAGWGAGQLESEMAQNSWLSVGADSH-IIFDVAPEDRYPAALKLLG 188
                  ****************************************666.****************998 PP



Or compare VIMSS511614 to CDD or PaperBLAST