PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS519157 to PF02622 (DUF179)

VIMSS519157 has 192 amino acids

Query:       DUF179  [M=160]
Accession:   PF02622.15
Description: Uncharacterized ACR, COG1678
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    4.9e-54  168.8   0.0    5.5e-54  168.6   0.0    1.0  1  VIMSS519157  


Domain annotation for each sequence (and alignments):
>> VIMSS519157  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  168.6   0.0   5.5e-54   5.5e-54       1     160 []      21     179 ..      21     179 .. 0.96

  Alignments for each domain:
  == domain 1  score: 168.6 bits;  conditional E-value: 5.5e-54
                  TTSTTTTSTTEEEEEEEEETTEEEEEESSSEEEEEHHHHHHHGCTSSSST-CHHHSEEEES-SEEEEEEEEEEES...SSSEEECSTTEEEE-SSHHH CS
       DUF179   1 psledpnFersVvlllehdeegalGlvlNrpleltlkelleelleleaepateklssvylGGPveqdrlfvlhsle.elessleisdglylttsldil 97 
                  p++ dp F++s v+l+eh e+ga+Gl++N+p+ +++++l+++ ++l  +++ +++  vy+GGPv++dr+fvlh+ + +++ssl ++d+++ltts+d+l
  VIMSS519157  21 PGMGDPLFAKSLVYLCEHGEHGAMGLIINKPSGIAMAQLFDQ-IDLPLDDEDTRTGLVYFGGPVQPDRGFVLHQPAgNWQSSLMVTDDIALTTSKDVL 117
                  89***************************************9.7888888888999******************55799******************* PP

                  HHHCSTTSCSSEEEEEEEEEECTTHHHHHHHTTSEEEEE-.HHHHHCTSTSSHHHHHHHHCCT CS
       DUF179  98 ealagkagpeklrvflGyagWeagQLeeEieegaWlvvpassedllfetppeelWeealrrlG 160
                   a++++++pe+l++ lGyagW+agQLe+Ei+++ Wl+vpa+++ ++f+ p ee++++a+++lG
  VIMSS519157 118 VAVSEGKKPEQLLISLGYAGWSAGQLEKEIADNGWLTVPAEPS-IVFDLPYEERYDAAMALLG 179
                  ****************************************777.***************9987 PP



Or compare VIMSS519157 to CDD or PaperBLAST