PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS53077 to PF02622 (DUF179)

VIMSS53077 has 187 amino acids

Query:       DUF179  [M=160]
Accession:   PF02622.15
Description: Uncharacterized ACR, COG1678
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    2.6e-56  176.2   0.0    2.9e-56  176.0   0.0    1.0  1  VIMSS53077  


Domain annotation for each sequence (and alignments):
>> VIMSS53077  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  176.0   0.0   2.9e-56   2.9e-56       1     160 []      12     174 ..      12     174 .. 0.94

  Alignments for each domain:
  == domain 1  score: 176.0 bits;  conditional E-value: 2.9e-56
                 TTSTTTTSTTEEEEEEEEETTEEEEEESSSEEEEEHHHHHHHGCTSSSST-CHHH...SEEEES-SEEEEEEEEEEES...SSSEEECSTTEEEE-SSH CS
      DUF179   1 psledpnFersVvlllehdeegalGlvlNrpleltlkelleelleleaepatekl...ssvylGGPveqdrlfvlhsle.elessleisdglylttsld 95 
                 ps++dp+F+rsV++++eh+++ga+Gl++N p+++t++ +l+++    a p+ +++   ++v++GGPv++dr+f+lh+ + + ess++++d++++tts+d
  VIMSS53077  12 PSMKDPYFKRSVIYICEHNQDGAMGLMINAPIDITVGGMLKQVDIEPAYPQSHQEnlkKPVFNGGPVSEDRGFILHRPRdHYESSMKMTDDIAVTTSKD 110
                 89****************************************7777666666555999*******************55699***************** PP

                 HHHHHCSTTSCSSEEEEEEEEEECTTHHHHHHHTTSEEEEE-.HHHHHCTSTSSHHHHHHHHCCT CS
      DUF179  96 ilealagkagpeklrvflGyagWeagQLeeEieegaWlvvpassedllfetppeelWeealrrlG 160
                 il+ l ++a+pe ++v+lGy+gW+agQLe E+ e++Wl+++a++e l+f+tp +e+W++a+++lG
  VIMSS53077 111 ILTVLGTEAEPEGYIVALGYSGWSAGQLEVELTENSWLTIEADPE-LIFNTPVHEKWQKAIQKLG 174
                 *****99***********************************666.****************998 PP



Or compare VIMSS53077 to CDD or PaperBLAST