PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS56856 to PF02622 (DUF179)

VIMSS56856 has 189 amino acids

Query:       DUF179  [M=160]
Accession:   PF02622.15
Description: Uncharacterized ACR, COG1678
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    1.7e-51  160.5   0.0    1.9e-51  160.4   0.0    1.0  1  VIMSS56856  


Domain annotation for each sequence (and alignments):
>> VIMSS56856  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  160.4   0.0   1.9e-51   1.9e-51       1     160 []      18     176 ..      18     176 .. 0.95

  Alignments for each domain:
  == domain 1  score: 160.4 bits;  conditional E-value: 1.9e-51
                 TTSTTTTSTTEEEEEEEEETTEEEEEESSSEEEEEHHHHHHHGCTSSSST-CHHHSEEEES-SEEEEEEEEEEES...SSSEEECSTTEEEE-SSHHHH CS
      DUF179   1 psledpnFersVvlllehdeegalGlvlNrpleltlkelleelleleaepateklssvylGGPveqdrlfvlhsle.elessleisdglylttsldile 98 
                 p++ dpnF+++V++l+eh+e+ga+Glv+Nrp+ l+l+e+le+l   + +pa+ +   +y+GGPv++dr+fvlh +  + +s+le+  +l+++ts+d+l 
  VIMSS56856  18 PHMADPNFAQTVTYLVEHNEQGAMGLVINRPSGLNLAEVLEQLKPDALPPARCQHIDIYNGGPVQTDRGFVLHPSGlSYQSTLELG-ELAMSTSQDVLF 115
                 89*****************************************999999999999*******************656777888887.9*********** PP

                 HHCSTTSCSSEEEEEEEEEECTTHHHHHHHTTSEEEEE-.HHHHHCTSTSSHHHHHHHHCCT CS
      DUF179  99 alagkagpeklrvflGyagWeagQLeeEieegaWlvvpassedllfetppeelWeealrrlG 160
                 a+a ++gpek ++ lGyagWeagQLe+E++++aWl++pa++  +lf+ ppee+ ++a +rlG
  VIMSS56856 116 AIAAGTGPEKSLISLGYAGWEAGQLEAELSDNAWLTCPADPA-ILFDLPPEERLSAAAARLG 176
                 **99***********************************666.**************99998 PP



Or compare VIMSS56856 to CDD or PaperBLAST