PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5925500 to PF02622 (DUF179)

VIMSS5925500 has 192 amino acids

Query:       DUF179  [M=160]
Accession:   PF02622.15
Description: Uncharacterized ACR, COG1678
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    6.3e-54  168.4   0.0    7.2e-54  168.3   0.0    1.0  1  VIMSS5925500  


Domain annotation for each sequence (and alignments):
>> VIMSS5925500  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  168.3   0.0   7.2e-54   7.2e-54       1     160 []      19     179 ..      19     179 .. 0.93

  Alignments for each domain:
  == domain 1  score: 168.3 bits;  conditional E-value: 7.2e-54
                   TTSTTTTSTTEEEEEEEEETTEEEEEESSSEEEEEHHHHHHHGCTSSSST-CHHHSEEEES-SEEEEEEEEEEES.....SSSEEECSTTEEEE-SS CS
        DUF179   1 psledpnFersVvlllehdeegalGlvlNrpleltlkelleelleleaepateklssvylGGPveqdrlfvlhsle...elessleisdglylttsl 94 
                   p++ dp+F+ +Vv+l++h+e+galGlv+Nrp++++l++l+++ ++l+ + +     +vy+GGPv+++r+fvlh+     + +ss++++ gl +tts+
  VIMSS5925500  19 PNMADPTFSGTVVYLCDHSERGALGLVINRPTDIDLESLFNR-IDLKLDIEPLLHIPVYFGGPVQTERGFVLHEPVegaSYNSSMSVDGGLEMTTSK 114
                   89***************************************9.6777676666669******************22456889*************** PP

                   HHHHHHCSTTSCSSEEEEEEEEEECTTHHHHHHHTTSEEEEE-.HHHHHCTSTSSHHHHHHHHCCT CS
        DUF179  95 dilealagkagpeklrvflGyagWeagQLeeEieegaWlvvpassedllfetppeelWeealrrlG 160
                   d+lea+a+++gp++++++lG+agW+agQLeeEi+++ Wl+v+a+++ ++f+tp+ee++e+al +lG
  VIMSS5925500 115 DVLEAVATGTGPKRFLLTLGHAGWGAGQLEEEISRNGWLTVAADPR-IVFDTPAEERFEAALGLLG 179
                   *******************************************666.***************9887 PP



Or compare VIMSS5925500 to CDD or PaperBLAST