PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6660 to PF02622 (DUF179)

VIMSS6660 has 186 amino acids

Query:       DUF179  [M=160]
Accession:   PF02622.15
Description: Uncharacterized ACR, COG1678
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence  Description
    ------- ------ -----    ------- ------ -----   ---- --  --------  -----------
    1.5e-49  154.2   0.0    1.7e-49  154.1   0.0    1.0  1  VIMSS6660  


Domain annotation for each sequence (and alignments):
>> VIMSS6660  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  154.1   0.0   1.7e-49   1.7e-49       2     160 .]      14     172 ..      13     172 .. 0.92

  Alignments for each domain:
  == domain 1  score: 154.1 bits;  conditional E-value: 1.7e-49
                TSTTTTSTTEEEEEEEEETTEEEEEESSSEEEEEHHHHHHHGCTSSSST-CHHHSEEEES-SEEEEEEEEEEES....SSSEEECSTTEEEE-SSHHHHH CS
     DUF179   2 sledpnFersVvlllehdeegalGlvlNrpleltlkelleelleleaepateklssvylGGPveqdrlfvlhsle..elessleisdglylttsldilea 99 
                +l d++F+r+Vv+++eh+e+g++Glv+N+p++l+++el ++l  + ++++t   + v+ GGP++++r+f+lh+++    +++ +++++l +tts d++e+
  VIMSS6660  14 HL-DDYFNRTVVFMCEHNEQGSMGLVINQPTDLSIAELYSKLNFMMKNDRTFGNEMVVAGGPMHTERGFILHKNTlnAFQHTYKVTKELSMTTSADVVET 112
                55.899***********************************665555555555599*****************6677999******************** PP

                HCSTTSCSSEEEEEEEEEECTTHHHHHHHTTSEEEEE-.HHHHHCTSTSSHHHHHHHHCCT CS
     DUF179 100 lagkagpeklrvflGyagWeagQLeeEieegaWlvvpassedllfetppeelWeealrrlG 160
                l  +  pek++v+lG+++W+agQLe+Ei+++aWlvv+  ++++lf+ p e+++++a ++lG
  VIMSS6660 113 LGSTFAPEKYLVALGCSSWGAGQLEKEIRDNAWLVVSS-NDQILFDMPYEDRYAAANQLLG 172
                *99**********************************9.666*************999887 PP



Or compare VIMSS6660 to CDD or PaperBLAST