PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS757049 to PF02622 (DUF179)

VIMSS757049 has 187 amino acids

Query:       DUF179  [M=160]
Accession:   PF02622.15
Description: Uncharacterized ACR, COG1678
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.6e-51  159.9   0.0    2.9e-51  159.8   0.0    1.0  1  VIMSS757049  


Domain annotation for each sequence (and alignments):
>> VIMSS757049  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  159.8   0.0   2.9e-51   2.9e-51       1     155 [.      16     169 ..      16     174 .. 0.93

  Alignments for each domain:
  == domain 1  score: 159.8 bits;  conditional E-value: 2.9e-51
                  TTSTTTTSTTEEEEEEEEETTEEEEEESSSEEEEEHHHHHHHGCTSSSST-CHHHSEEEES-SEEEEEEEEEEES...SSSEEECSTTEEEE-SSHHH CS
       DUF179   1 psledpnFersVvlllehdeegalGlvlNrpleltlkelleelleleaepateklssvylGGPveqdrlfvlhsle.elessleisdglylttsldil 97 
                  psl+dpnFersVv+l+eh+e+g++Gl++Nrpl++ l+ ++e+ l++e    +++  ++++GGPv+++r+fv+h++  +++ssl ++d++++tts di+
  VIMSS757049  16 PSLKDPNFERSVVYLCEHNEQGSVGLIINRPLQFPLSIVFEQ-LQIEPIRVEKNGLPLLFGGPVQPERGFVIHKQMgGWRSSLFLQDEVTVTTSNDII 112
                  89***************************************9.6677666666779******************55799******************* PP

                  HHHCSTTSCSSEEEEEEEEEECTTHHHHHHHTTSEEEEE-.HHHHHCTSTSSHHHHHH CS
       DUF179  98 ealagkagpeklrvflGyagWeagQLeeEieegaWlvvpassedllfetppeelWeea 155
                  +a+a ++gp++++++lGya+W+++QLe+Ei +++Wlv+p +se +l e p ee+We a
  VIMSS757049 113 RAIAYDEGPKDVLITLGYAAWTEQQLEREIMSNTWLVCPYKSE-ILYEVPFEERWEYA 169
                  ****************************************666.***********977 PP



Or compare VIMSS757049 to CDD or PaperBLAST