PaperBLAST – Find papers about a protein or its homologs

 

Align WP_013182292.1 to PF02622 (DUF179)

WP_013182292.1 has 189 amino acids

Query:       DUF179  [M=160]
Accession:   PF02622.15
Description: Uncharacterized ACR, COG1678
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.4e-43  134.0   0.0    2.8e-43  133.8   0.0    1.0  1  WP_013182292.1  


Domain annotation for each sequence (and alignments):
>> WP_013182292.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  133.8   0.0   2.8e-43   2.8e-43       1     160 []      19     173 ..      19     173 .. 0.92

  Alignments for each domain:
  == domain 1  score: 133.8 bits;  conditional E-value: 2.8e-43
                     TTSTTTTSTTEEEEEEEEETTEEEEEESSSEEEEEHHHHHHHGCTSSSST-CHHHSEEEES-SEEEEEEEEEEES...SSSEEECSTTEEEE-SS CS
          DUF179   1 psledpnFersVvlllehdeegalGlvlNrpleltlkelleelleleaepateklssvylGGPveqdrlfvlhsle.elessleisdglylttsl 94 
                     p++e + F rsVvl++eh+ +g++Glv+N+ l+l+l e + ++ el++++       +  GGPv+++++++lh+++   +++l++ +g+yl+++l
  WP_013182292.1  19 PDIEAGIFFRSVVLICEHNPNGSFGLVINKSLDLELPEEIIKTEELQNPNIG-----IRAGGPVQTNQMMLLHTSPsIPQQTLQVCHGVYLGGDL 108
                     7789999****************************99999887777766544.....*****************77656789************* PP

                     HHHHHHCSTTSCSSEEEEEEEEEECTTHHHHHHHTTSEEEEE-.HHHHHCTSTSSHHHHHHHHCCT CS
          DUF179  95 dilealagkagpeklrvflGyagWeagQLeeEieegaWlvvpassedllfetppeelWeealrrlG 160
                     + l+    +++   ++++ GyagW+agQLe+E  +g W+  pa+++ l+f+tppe+lW+++lr++G
  WP_013182292.1 109 QFLQGTIIDSEGPSVLLCFGYAGWGAGQLEREFLDGGWFLYPAEQH-LIFSTPPEKLWQTILREMG 173
                     ****9966777778999**************************777.*****************98 PP



Or compare WP_013182292.1 to CDD or PaperBLAST