PaperBLAST – Find papers about a protein or its homologs

 

Align WP_044028928.1 to PF02622 (DUF179)

WP_044028928.1 has 184 amino acids

Query:       DUF179  [M=160]
Accession:   PF02622.15
Description: Uncharacterized ACR, COG1678
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.3e-53  166.6   0.0    2.6e-53  166.4   0.0    1.0  1  WP_044028928.1  


Domain annotation for each sequence (and alignments):
>> WP_044028928.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  166.4   0.0   2.6e-53   2.6e-53       1     160 []      12     171 ..      12     171 .. 0.95

  Alignments for each domain:
  == domain 1  score: 166.4 bits;  conditional E-value: 2.6e-53
                     TTSTTTTSTTEEEEEEEEETTEEEEEESSSEEEEEHHHHHHHGCTSSSST-CHHHSEEEES-SEEEEEEEEEEES....SSSEEECSTTEEEE-S CS
          DUF179   1 psledpnFersVvlllehdeegalGlvlNrpleltlkelleelleleaepateklssvylGGPveqdrlfvlhsle..elessleisdglyltts 93 
                     p++ dp+FersV++l++h e+ga+Gl++N+p +l++++lle+ le+ +++a+++  +v lGGPve+ r+fvlhs +  +  +sl++sdg+++t++
  WP_044028928.1  12 PGMGDPRFERSVIFLCSHGEDGAMGLIVNKPADLNVSTLLEQ-LEIPSSSAAAARAPVRLGGPVEMARGFVLHSPDyaGKLQSLKVSDGFVMTAT 105
                     89***************************************9.788888888899*******************54666779************* PP

                     SHHHHHHCSTTSCSSEEEEEEEEEECTTHHHHHHHTTSEEEEE-.HHHHHCTSTSSHHHHHHHHCCT CS
          DUF179  94 ldilealagkagpeklrvflGyagWeagQLeeEieegaWlvvpassedllfetppeelWeealrrlG 160
                     ldile++a+++gp++  ++lGy+gW++gQLe+Ei ++ Wl+++a+++ ++f+++++ +We+al++lG
  WP_044028928.1 106 LDILEDIARDNGPARAALMLGYSGWGPGQLEAEIGDNGWLTADADPD-IVFGSRDDGKWEAALKLLG 171
                     ********************************************666.****************998 PP



Or compare WP_044028928.1 to CDD or PaperBLAST