PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS34045 to PF02656 (DUF202)

VIMSS34045 has 122 amino acids

Query:       DUF202  [M=68]
Accession:   PF02656.15
Description: Domain of unknown function (DUF202)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    5.3e-22   64.4   8.8    1.7e-21   62.8   5.4    2.0  2  VIMSS34045  


Domain annotation for each sequence (and alignments):
>> VIMSS34045  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   62.8   5.4   1.7e-21   1.7e-21       1      67 [.      17      83 ..      17      84 .. 0.93
   2 !    3.2   0.1     0.007     0.007      36      58 ..      95     115 ..      86     120 .. 0.54

  Alignments for each domain:
  == domain 1  score: 62.8 bits;  conditional E-value: 1.7e-21
      DUF202  1 rdglAnERTfLaWlRtslalialglallrffltgepsalgkilglilivlgiltllvglvrylrrqr 67
                r  lAnERTfLaW Rt+l+l+a+++al+++  +     ++++lg++l++l+ilt ++gl r+++  r
  VIMSS34045 17 RFTLANERTFLAWQRTALGLLAAAVALVQLVPELTIPGARQVLGVVLAILAILTSGMGLLRWQQADR 83
                789***************************8877777789***********************9866 PP

  == domain 2  score: 3.2 bits;  conditional E-value: 0.007
      DUF202  36 psalgkilglilivlgiltllvg 58 
                 p+++   l+++l v+g+++l+++
  VIMSS34045  95 PTPG--YLAVGLCVVGVVALALV 115
                 5553..34444555555554443 PP



Or compare VIMSS34045 to CDD or PaperBLAST