PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5915212 to PF02656 (DUF202)

VIMSS5915212 has 122 amino acids

Query:       DUF202  [M=68]
Accession:   PF02656.15
Description: Domain of unknown function (DUF202)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    9.3e-20   57.2   8.3    9.3e-20   57.2   8.3    1.9  2  VIMSS5915212  


Domain annotation for each sequence (and alignments):
>> VIMSS5915212  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   57.2   8.3   9.3e-20   9.3e-20       1      67 [.      21      87 ..      21      88 .. 0.95
   2 ?    0.4   0.6      0.05      0.05      45      56 ..     106     117 ..      94     122 .] 0.50

  Alignments for each domain:
  == domain 1  score: 57.2 bits;  conditional E-value: 9.3e-20
        DUF202  1 rdglAnERTfLaWlRtslalialglallrffltgepsalgkilglilivlgiltllvglvrylrrqr 67
                  r  lAnERTfLaW+Rtsla++a g+a+ +f+ +g   +++  +++++i++g+++++ ++vr++ ++r
  VIMSS5915212 21 RFTLANERTFLAWTRTSLAFLAGGIAFEAFQISGLSDTVRTTIAVFIIAVGMIIAAGAAVRWMNVER 87
                  789**************************99999999999***********************9987 PP

  == domain 2  score: 0.4 bits;  conditional E-value: 0.05
        DUF202  45 lilivlgiltll 56 
                   ++++v+++++l+
  VIMSS5915212 106 IAALVASAAVLV 117
                   222222222222 PP



Or compare VIMSS5915212 to CDD or PaperBLAST