PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5915213 to PF02656 (DUF202)

VIMSS5915213 has 105 amino acids

Query:       DUF202  [M=68]
Accession:   PF02656.15
Description: Domain of unknown function (DUF202)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    8.3e-17   47.8   2.7    8.3e-17   47.8   2.7    2.0  2  VIMSS5915213  


Domain annotation for each sequence (and alignments):
>> VIMSS5915213  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   47.8   2.7   8.3e-17   8.3e-17       1      65 [.       6      68 ..       6      71 .. 0.94
   2 ?    0.8   1.1     0.037     0.037      16      24 ..      90      98 ..      69     104 .. 0.53

  Alignments for each domain:
  == domain 1  score: 47.8 bits;  conditional E-value: 8.3e-17
        DUF202  1 rdglAnERTfLaWlRtslalialglallrffltgepsalgkilglilivlgiltllvglvrylrr 65
                  ++gl++ERT LaW Rt+++l++ ++ llr+  t+    ++ +  +il +++i++l++ +vry r+
  VIMSS5915213  6 DPGLQPERTVLAWNRTTVSLAVCSAILLRW--TNFYGIFALLPVVILSGMAIFILFTQRVRYERQ 68
                  79****************************..888889889999******************986 PP

  == domain 2  score: 0.8 bits;  conditional E-value: 0.037
        DUF202 16 tslalialg 24
                  t+la++a+g
  VIMSS5915213 90 TLLAFGAAG 98
                  222222222 PP



Or compare VIMSS5915213 to CDD or PaperBLAST