PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6582490 to PF02656 (DUF202)

VIMSS6582490 has 828 amino acids

Query:       DUF202  [M=68]
Accession:   PF02656.15
Description: Domain of unknown function (DUF202)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    9.8e-16   44.3   0.7      2e-15   43.3   0.2    1.7  2  VIMSS6582490  


Domain annotation for each sequence (and alignments):
>> VIMSS6582490  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   43.3   0.2     2e-15     2e-15       1      66 [.     686     751 ..     686     752 .. 0.96
   2 ?   -2.5   0.0       0.4       0.4      42      55 ..     770     783 ..     755     793 .. 0.45

  Alignments for each domain:
  == domain 1  score: 43.3 bits;  conditional E-value: 2e-15
        DUF202   1 rdglAnERTfLaWlRtslalialglallrffltgepsalgkilglilivlgiltllvglvrylrrq 66 
                   +++lAnERTf  Wl+++ +l +l + ++++ ++ e  +l+  +++++++l+i+++l+++  y++r+
  VIMSS6582490 686 KVWLANERTFNRWLSVTSLLSVLTFSIYNSVKKAEYPTLANYMAYVYFGLTIFCALWSYSIYMKRV 751
                   68************************************************************9886 PP

  == domain 2  score: -2.5 bits;  conditional E-value: 0.4
        DUF202  42 ilglilivlgiltl 55 
                   +++++l+v+ ++ +
  VIMSS6582490 770 LVSIVLFVTLVVNF 783
                   22233333333322 PP



Or compare VIMSS6582490 to CDD or PaperBLAST