PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6586672 to PF02656 (DUF202)

VIMSS6586672 has 835 amino acids

Query:       DUF202  [M=68]
Accession:   PF02656.15
Description: Domain of unknown function (DUF202)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    2.8e-15   42.9   2.3    2.8e-15   42.9   2.3    1.7  2  VIMSS6586672  


Domain annotation for each sequence (and alignments):
>> VIMSS6586672  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   42.9   2.3   2.8e-15   2.8e-15       1      66 [.     698     763 ..     698     765 .. 0.96
   2 ?   -2.2   0.0      0.34      0.34      42      53 ..     782     793 ..     769     807 .. 0.49

  Alignments for each domain:
  == domain 1  score: 42.9 bits;  conditional E-value: 2.8e-15
        DUF202   1 rdglAnERTfLaWlRtslalialglallrffltgepsalgkilglilivlgiltllvglvrylrrq 66 
                   +++lAnERTf  Wl+++++l +l + ++++ ++ e  +l+ +l+++++ l++++ ++++++yl+r 
  VIMSS6586672 698 KVWLANERTFNRWLSVTTLLSVLTFSIYNSVQKAEFPQLADLLAYVYFFLTLFCGVWAYRTYLKRL 763
                   68************************************************************9986 PP

  == domain 2  score: -2.2 bits;  conditional E-value: 0.34
        DUF202  42 ilglilivlgil 53 
                   +++++liv+ ++
  VIMSS6586672 782 LVAVVLIVTLVV 793
                   223333333333 PP



Or compare VIMSS6586672 to CDD or PaperBLAST