PaperBLAST – Find papers about a protein or its homologs

 

Align XP_002295322.1 to PF02656 (DUF202)

XP_002295322.1 has 589 amino acids

Query:       DUF202  [M=68]
Accession:   PF02656.19
Description: Domain of unknown function (DUF202)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    6.5e-16   44.9   3.7    1.4e-15   43.8   3.7    1.6  1  XP_002295322.1  


Domain annotation for each sequence (and alignments):
>> XP_002295322.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   43.8   3.7   1.4e-15   1.4e-15       3      66 ..     477     539 ..     475     541 .. 0.91

  Alignments for each domain:
  == domain 1  score: 43.8 bits;  conditional E-value: 1.4e-15
          DUF202   3 glAnERTfLaWlRtslalialgvallrffleggptalalilglilivlgiltlllalvrylrre 66 
                     ++AnERTfL Wl+ +++l ++++++l f+ + +  + a++ +++l+ +++ + l+al+ +l+r+
  XP_002295322.1 477 FFANERTFLHWLHAGVTLYTIAAGILAFASDTHSIG-AHWYAMALLPISLGFCLYALHIFLWRA 539
                     79*************************976666555.8************************97 PP



Or compare XP_002295322.1 to CDD or PaperBLAST