PaperBLAST – Find papers about a protein or its homologs

 

Align XP_012049426.1 to PF02656 (DUF202)

XP_012049426.1 has 864 amino acids

Query:       DUF202  [M=68]
Accession:   PF02656.15
Description: Domain of unknown function (DUF202)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.2e-14   40.8   1.1    2.8e-14   39.7   1.1    1.6  1  XP_012049426.1  


Domain annotation for each sequence (and alignments):
>> XP_012049426.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   39.7   1.1   2.8e-14   2.8e-14       1      67 [.     762     826 ..     762     829 .. 0.71

  Alignments for each domain:
  == domain 1  score: 39.7 bits;  conditional E-value: 2.8e-14
          DUF202   1 rdglAnERTfLaWlRtslalialglallrffltgepsalgkilglilivlgiltllvglvrylrrqr 67 
                     ++++A+ERTfL W +++++l a++++ll+f  + +    g++ +  +  +++ ++l+    y +r r
  XP_012049426.1 762 KVVFAAERTFLKWAHFAILLSAVSIGLLNFIDPTDAV--GMVSAGCFTFTSLSAILYCGGMYAWRIR 826
                     689**************************94444433..4555555555555555555555555544 PP



Or compare XP_012049426.1 to CDD or PaperBLAST