PaperBLAST – Find papers about a protein or its homologs

 

Align XP_846013.1 to PF02656 (DUF202)

XP_846013.1 has 180 amino acids

Query:       DUF202  [M=68]
Accession:   PF02656.15
Description: Domain of unknown function (DUF202)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    3.6e-20   58.5   0.2    4.6e-19   55.0   0.1    2.1  2  XP_846013.1  


Domain annotation for each sequence (and alignments):
>> XP_846013.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   55.0   0.1   4.6e-19   4.6e-19       1      65 [.      62     124 ..      62     127 .. 0.91
   2 ?    1.5   0.0     0.023     0.023      35      58 ..     141     161 ..     133     171 .. 0.53

  Alignments for each domain:
  == domain 1  score: 55.0 bits;  conditional E-value: 4.6e-19
       DUF202   1 rdglAnERTfLaWlRtslalialglallrffltgepsalgkilglilivlgiltllvglvrylrr 65 
                  ++++AnERTfL W+++s+++++++l+ll+f  t+++++   ++gl+l++++il+++ +l+ +  r
  XP_846013.1  62 KTFFANERTFLKWMSISVMIGMMSLTLLNFGDTSSNAS--ELAGLVLLPVSILFMIHSLFVFKDR 124
                  69****************************77777776..*****************99988766 PP

  == domain 2  score: 1.5 bits;  conditional E-value: 0.023
       DUF202  35 epsalgkilglilivlgiltllvg 58 
                  +p+ l  +lg+ l +++i++   +
  XP_846013.1 141 GPTILVLVLGVSLGIAAIFS---V 161
                  55555555554444444444...3 PP



Or compare XP_846013.1 to CDD or PaperBLAST