PaperBLAST – Find papers about a protein or its homologs

 

Align ecocyc::EG11696-MONOMER to PF02656 (DUF202)

ecocyc::EG11696-MONOMER has 115 amino acids

Query:       DUF202  [M=68]
Accession:   PF02656.15
Description: Domain of unknown function (DUF202)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                -----------
    1.7e-20   59.6   6.0    7.6e-20   57.5   1.7    2.0  2  ecocyc::EG11696-MONOMER  


Domain annotation for each sequence (and alignments):
>> ecocyc::EG11696-MONOMER  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   57.5   1.7   7.6e-20   7.6e-20       1      67 [.      13      79 ..      13      80 .. 0.95
   2 !    4.7   0.2    0.0023    0.0023      41      60 ..      94     113 ..      82     114 .. 0.77

  Alignments for each domain:
  == domain 1  score: 57.5 bits;  conditional E-value: 7.6e-20
                   DUF202  1 rdglAnERTfLaWlRtslalialglallrffltgepsalgkilglilivlgiltllvglvrylrrqr 67
                             r  lAnERTfLaW+Rt+l+++a+g++l ++  ++    ++ +l+l+l +++  ++ +g+ r+lr+++
  ecocyc::EG11696-MONOMER 13 RFSLANERTFLAWIRTALGFLAAGVGLDQLAPDFATPVIRELLALLLCLFSGGLAMYGYLRWLRNEK 79
                             6779**************************999999999************************9987 PP

  == domain 2  score: 4.7 bits;  conditional E-value: 0.0023
                   DUF202  41 kilglilivlgiltllvglv 60 
                               i++lil+v+++++++++l+
  ecocyc::EG11696-MONOMER  94 LIISLILMVVAVIVMGLVLY 113
                              67889999999999988776 PP



Or compare ecocyc::EG11696-MONOMER to CDD or PaperBLAST