PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q87VB1 to PF02696 (UPF0061)

SwissProt::Q87VB1 has 487 amino acids

Query:       UPF0061  [M=468]
Accession:   PF02696.14
Description: Uncharacterized ACR, YdiU/UPF0061 family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
   1.4e-157  511.2   0.0   1.6e-157  511.0   0.0    1.0  1  SwissProt::Q87VB1  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q87VB1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  511.0   0.0  1.6e-157  1.6e-157       4     466 ..       6     456 ..       3     458 .. 0.96

  Alignments for each domain:
  == domain 1  score: 511.0 bits;  conditional E-value: 1.6e-157
            UPF0061   4 kleyepaleslgsdfydeveaaefpkkilrvrndalleelgldeeevkdeelieifgke...kgiepflalrYhGyQFGeynpqLGDGRgfl 92 
                        +l + +++++lg++f+++v ++ ++  +l+v++++ l+ l+l +e+ +   ++eif+++    + ep  a++Y+G+QFG+ynp+LGDGRg+l
  SwissProt::Q87VB1   6 ELVFDNRFARLGDAFSTHVLPEPIDAPRLVVASESALALLDLAPEQSELPLFAEIFSGHklwAEAEPR-AMVYSGHQFGSYNPRLGDGRGLL 96 
                        57899*****************************************************9888899999.*********************** PP

            UPF0061  93 lgqvrdkdgelydfglKGsGlTPySRsaDGrlvLksgvREvlasealhklgvrtsralslietgekllRedePspersavvvRlarshiRfG 184
                        lg+v +  ge++d++lKG+G+TPySR++DGr+vL+s++RE+lasealh+lg+++sra +++++++ ++Re   ++e +a+v+Rla+sh+RfG
  SwissProt::Q87VB1  97 LGEVYNDAGEHWDLHLKGAGRTPYSRMGDGRAVLRSSIREFLASEALHALGIPSSRAACVVSSNTPVWRE---KQEYAAMVLRLAQSHVRFG 185
                        **********************************************************************...******************* PP

            UPF0061 185 tferlkylkrldllkkLldyvieeyypeladeeekyaqfyaelvervAelvAqWmaaGFchgVlNTDNmsilGeslDYGPyaFldkydpkft 276
                        ++e l y+k++++lk+L+++v++ +yp+++++ e y ++++e+ver+Ael+A+W+a+GFchgV+NTDNmsilG+++D+GP+aFld++d +f+
  SwissProt::Q87VB1 186 SLEYLFYTKQPEHLKTLAEHVLTMHYPHCQEQPEPYLAMFREIVERNAELIAKWQAYGFCHGVMNTDNMSILGITFDFGPFAFLDDFDEHFI 277
                        ******************************************************************************************** PP

            UPF0061 277 aayfDyagrYsyanQpsiilwNLeqlaeplallieaeeleealeeykevyttkYaqlmlkkLGleklsekekefdselleellelLqetqvd 368
                        ++++D++grYs++nQ  i++wNL++l ++l+ +++ e+l e++  +   y+++Y +lm+++LGl    + ++++d++l+++ll+l+q++ vd
  SwissProt::Q87VB1 278 CNHSDHEGRYSFSNQVPIAQWNLSALGQALTPFVSVEALRETIGLFLPLYQAHYLDLMRRRLGL----TVAQDQDDKLVSQLLQLMQNSGVD 365
                        ****************************************************************....55556667**************** PP

            UPF0061 369 YneffveLaeskskkwrdeaesileesekeleeekleeWrelYkklleeleedeleeraerlkkvNpktvllrplieeviekiaeeddlspl 460
                        Y+ ff++L ++   ++ +    + +  ++ ++ + +++W ++Y+++++ +e+ + ++r+er++ vNp+++l+++l++++ie+ ae+ d++++
  SwissProt::Q87VB1 366 YTLFFRRLGDQPAAQALRA---L-R--DDFVDIKVFDDWAQAYQARIAAEENGTEQARKERMHAVNPLYILRNYLAQNAIEA-AEKGDYEEV 450
                        ********99876665422...2.2..23356788***********************************************.********* PP

            UPF0061 461 kkllek 466
                        ++l++ 
  SwissProt::Q87VB1 451 RRLHQV 456
                        ***986 PP



Or compare SwissProt::Q87VB1 to CDD or PaperBLAST