PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1139435 to PF02696 (UPF0061)

VIMSS1139435 has 481 amino acids

Query:       UPF0061  [M=468]
Accession:   PF02696.14
Description: Uncharacterized ACR, YdiU/UPF0061 family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
   2.6e-121  391.7   0.0     3e-121  391.4   0.0    1.0  1  VIMSS1139435  


Domain annotation for each sequence (and alignments):
>> VIMSS1139435  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  391.4   0.0    3e-121    3e-121       6     467 ..       4     450 ..       1     451 [. 0.94

  Alignments for each domain:
  == domain 1  score: 391.4 bits;  conditional E-value: 3e-121
       UPF0061   6 eyepaleslgsdfydeveaaefpkkilrvrndalleelgldeeevkdeelieifgke...kgiepflalrYhGyQFGeynpqLGDGRgfllgqvrdk 99 
                    + +++++  + fy   +aa +p  +l+  n+ l+eelgld++ ++ +e +eif++    +g +p+ a++Y+G+QFG + pqLGDGR++l g++ d+
  VIMSS1139435   4 RFDNSYARDLEGFYVDWPAAPVPAPRLLRLNRPLAEELGLDPDLLE-REGAEIFSGRrlpEGAHPL-AQAYAGHQFGGFSPQLGDGRALLIGEITDR 98 
                   67888999999******************************77665.67799***99999999**9.****************************** PP

       UPF0061 100 dgelydfglKGsGlTPySRsaDGrlvLksgvREvlasealhklgvrtsralslietgekllRedePspersavvvRlarshiRfGtferlkylkrld 196
                    g+  d++lKGsG+TP+SR+aDG++ L   +RE+l++ea+h lg++t+ral  + tge llR+   ++ ++a++ R+a shiR+Gtf+ + ++++ d
  VIMSS1139435  99 AGRRRDLQLKGSGRTPFSRGADGKAALGPVLREYLVGEAMHGLGIPTTRALAAVATGEPLLRQ--EGERPGAILTRVAASHIRVGTFQFFAARSDID 193
                   **************************************************************9..68899*************************** PP

       UPF0061 197 llkkLldyvieeyypeladeeekyaqfyaelvervAelvAqWmaaGFchgVlNTDNmsilGeslDYGPyaFldkydpkftaayfDyagrYsyanQps 293
                   ++++L+dy+i+ +ypela+  e y +fy+ + e +A+lvA Wm +GF+hgV+NTDNm+i Ge++DYGP aF++ ydp  +    D +grY+y+nQp+
  VIMSS1139435 194 RVRRLADYAIARHYPELASAPEPYLAFYEAVAEAQAQLVARWMLVGFIHGVMNTDNMTISGETIDYGPCAFMEGYDPGTVFSSIDLQGRYAYGNQPY 290
                   ************************************************************************************************* PP

       UPF0061 294 iilwNLeqlaeplalli......eaeeleealeeykevyttkYaqlmlkkLGleklsekekefdselleellelLqetqvdYneffveLaeskskkw 384
                   i  wNL++l e+l  l+      +a++ ++ le+   +y+ ++ + m++kLGl      ++e d++l e+lle ++++++d++ +f++Lae  +++ 
  VIMSS1139435 291 ILAWNLARLGEALLPLLdgdpvrAADKATSVLETVGARYQGHWLAGMRAKLGL----AGAEEGDARLAEDLLEAMRSQRADWTLTFRRLAEAVTDEG 383
                   *****************7777776777778888********************....555566789*************************988776 PP

       UPF0061 385 rdeaesileesekeleeekleeWrelYkklleeleedeleeraerlkkvNpktvllrplieeviekiaeeddlsplkkllekl 467
                   +      l+   +  + ++l  W  +++++l+        + aer++ +Np ++ ++  +ee++ + a+  dl p+++lle+l
  VIMSS1139435 384 A------LRPLFR--DPAALAGWLPRWRARLAP-------DAAERMRATNPIYIARNHRVEEALAA-AHAGDLAPFDRLLEAL 450
                   5......233333..66899***********94.......467899*******************9.99**********9875 PP



Or compare VIMSS1139435 to CDD or PaperBLAST