PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS15825 to PF02696 (UPF0061)

VIMSS15825 has 478 amino acids

Query:       UPF0061  [M=468]
Accession:   PF02696.14
Description: Uncharacterized ACR, YdiU/UPF0061 family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
   9.7e-161  521.6   0.0   1.1e-160  521.5   0.0    1.0  1  VIMSS15825  


Domain annotation for each sequence (and alignments):
>> VIMSS15825  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  521.5   0.0  1.1e-160  1.1e-160       4     467 ..       2     450 ..       1     451 [. 0.95

  Alignments for each domain:
  == domain 1  score: 521.5 bits;  conditional E-value: 1.1e-160
     UPF0061   4 kleyepaleslgsdfydeveaaefpkkilrvrndalleelgldeeevkdeelieifgke...kgiepflalrYhGyQFGeynpqLGDGRgfllgqvrdk 99 
                 +l++ ++++++  + y+ ++++ +++ +l+++n++l+++l + ++ +k  + + ++g+e    g++p+ a++Y+G+QFG +++qLGDGRg+llg+    
  VIMSS15825   2 TLSFVTRWRDELPETYTALSPTPLNNARLIWHNTELANTLSIPSSLFK--NGAGVWGGEallPGMSPL-AQVYSGHQFGVWAGQLGDGRGILLGEQLLA 97 
                 688999************************************977776..56799****9999****9.****************************** PP

     UPF0061 100 dgelydfglKGsGlTPySRsaDGrlvLksgvREvlasealhklgvrtsralslietgekllRedePspersavvvRlarshiRfGtferlkylkrldll 198
                 dg+++d++lKG+GlTPySR++DGr+vL+s++RE lasea+h lg++t+rals++++++ ++Re   + e++a+++R+a+sh+RfG+fe+++y+++++++
  VIMSS15825  98 DGTTMDWHLKGAGLTPYSRMGDGRAVLRSTIRESLASEAMHYLGIPTTRALSIVTSDSPVYRE---TAEPGAMLMRVAPSHLRFGHFEHFYYRRESEKV 193
                 ***************************************************************...********************************* PP

     UPF0061 199 kkLldyvieeyypeladeeekyaqfyaelvervAelvAqWmaaGFchgVlNTDNmsilGeslDYGPyaFldkydpkftaayfDyagrYsyanQpsiilw 297
                 ++L+d++i++y+++lad+e+ky+++++++v r+A+l+AqW+++GF+hgV+NTDNms+lG++lDYGP++Fld+y+p f+++++D++grYs++nQp+++lw
  VIMSS15825 194 RQLADFAIRHYWSHLADDEDKYRLWFSDVVARTASLIAQWQTVGFAHGVMNTDNMSLLGLTLDYGPFGFLDDYEPGFICNHSDHQGRYSFDNQPAVALW 292
                 *************************************************************************************************** PP

     UPF0061 298 NLeqlaeplallieaeeleealeeykevyttkYaqlmlkkLGleklsekekefdselleellelLqetqvdYneffveLaeskskkwrdeaesileese 396
                 NL++la++l+ +++ ++l+eal++y++v+ t+Y + m++kLG+    ++e+++d++ll+el++l+++++ dY+++f+ L+ ++++++++  +       
  VIMSS15825 293 NLQRLAQTLSPFVAVDALNEALDSYQQVLLTHYGERMRQKLGF----MTEQKEDNALLNELFSLMARERSDYTRTFRMLSLTEQHSAASPLRDE----- 382
                 *******************************************....44444479**************************9998876443332..... PP

     UPF0061 397 keleeekleeWrelYkklleeleedeleeraerlkkvNpktvllrplieeviekiaeeddlsplkkllekl 467
                   ++++++++W ++Y+ +l++ e  + +er++ +++vNp++vl+++l++++ie+ ae+ d+++l++l+e+l
  VIMSS15825 383 -FIDRAAFDDWFARYRGRLQQDEV-SDSERQQLMQSVNPALVLRNWLAQRAIEA-AEKGDMTELHRLHEAL 450
                 .467899*************8766.88999************************.************9976 PP



Or compare VIMSS15825 to CDD or PaperBLAST