PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS303879 to PF02696 (UPF0061)

VIMSS303879 has 478 amino acids

Query:       UPF0061  [M=468]
Accession:   PF02696.14
Description: Uncharacterized ACR, YdiU/UPF0061 family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   2.3e-161  523.7   0.0   2.6e-161  523.5   0.0    1.0  1  VIMSS303879  


Domain annotation for each sequence (and alignments):
>> VIMSS303879  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  523.5   0.0  2.6e-161  2.6e-161       4     467 ..       2     450 ..       1     451 [. 0.95

  Alignments for each domain:
  == domain 1  score: 523.5 bits;  conditional E-value: 2.6e-161
      UPF0061   4 kleyepaleslgsdfydeveaaefpkkilrvrndalleelgldeeevkdeelieifgke...kgiepflalrYhGyQFGeynpqLGDGRgfllgqvrd 98 
                  +l++ ++++++  + y+ ++++ +++ +l+++n++l+++l + ++ +k  + + ++g+e    g++p+ a++Y+G+QFG +++qLGDGRg+llg+   
  VIMSS303879   2 TLSFITRWRDELPETYTALSPTPLNNARLIWHNTELANTLSIPSSLFK--NGAGVWGGEnllPGMSPL-AQVYSGHQFGVWAGQLGDGRGILLGEQLL 96 
                  688999************************************977776..56799***99999****9.***************************** PP

      UPF0061  99 kdgelydfglKGsGlTPySRsaDGrlvLksgvREvlasealhklgvrtsralslietgekllRedePspersavvvRlarshiRfGtferlkylkrld 196
                   dg+++d++lKG+GlTPySR++DGr+vL+s++RE lasea+h lg++t+rals++++++ ++Re   + e +a+++R+a+sh+RfG+fe+++y+++++
  VIMSS303879  97 ADGTTMDWHLKGAGLTPYSRMGDGRAVLRSTIRESLASEAMHYLGIPTTRALSIVTSDSPVYRE---TVESGAMLMRVAPSHLRFGHFEHFYYRREPE 191
                  ****************************************************************...******************************* PP

      UPF0061 197 llkkLldyvieeyypeladeeekyaqfyaelvervAelvAqWmaaGFchgVlNTDNmsilGeslDYGPyaFldkydpkftaayfDyagrYsyanQpsi 294
                  ++++L+d++i++y+++l dee+ky+++++++v r+A+l+AqW+++GF+hgV+NTDNms+lG++lDYGP++Fld+y+p f+++++D++grYs++nQp++
  VIMSS303879 192 KVRQLADFAIRHYWSHLDDEEDKYRLWFTDVVARTASLIAQWQTVGFAHGVMNTDNMSLLGLTLDYGPFGFLDDYEPGFICNHSDHQGRYSFDNQPAV 289
                  ************************************************************************************************** PP

      UPF0061 295 ilwNLeqlaeplallieaeeleealeeykevyttkYaqlmlkkLGleklsekekefdselleellelLqetqvdYneffveLaeskskkwrdeaesil 392
                  +lwNL++la++l+ +++ ++l+eal++y++v+ t+Y q m++kLG+    ++e+++d++ll+el++l+++++ dY+++f+ L+ ++++++++  +   
  VIMSS303879 290 ALWNLQRLAQTLSPFVAVDALNEALDSYQQVLLTHYGQRMRQKLGF----MTEQKEDNALLNELFSLMARERSDYTRTFRMLSLTEQHSAASPLRDE- 382
                  **********************************************....44444479**************************9998876443332. PP

      UPF0061 393 eesekeleeekleeWrelYkklleeleedeleeraerlkkvNpktvllrplieeviekiaeeddlsplkkllekl 467
                        ++++++++W ++Y+ +l++ e  + +er++ +++vNp++vl+++l++++ie+ ae+dd+++l++l+e+l
  VIMSS303879 383 -----FIDRAAFDDWFARYRGRLQQDEI-TDSERQQLMQSVNPALVLRNWLAQRAIEA-AEKDDMTELHRLHEAL 450
                  .....467899*************8766.78899************************.************9976 PP



Or compare VIMSS303879 to CDD or PaperBLAST