PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS512376 to PF02696 (UPF0061)

VIMSS512376 has 487 amino acids

Query:       UPF0061  [M=468]
Accession:   PF02696.14
Description: Uncharacterized ACR, YdiU/UPF0061 family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   4.2e-127  410.7   0.0   5.4e-127  410.4   0.0    1.1  1  VIMSS512376  


Domain annotation for each sequence (and alignments):
>> VIMSS512376  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  410.4   0.0  5.4e-127  5.4e-127       7     465 ..      11     455 ..       5     458 .. 0.92

  Alignments for each domain:
  == domain 1  score: 410.4 bits;  conditional E-value: 5.4e-127
      UPF0061   7 yepaleslgsdfydeveaaefpkkilrvrndalleelgldeeevkdeelieifgke...kgiepflalrYhGyQFGeynpqLGDGRgfllgqvrdkdg 101
                    ++++ l ++fy++++++     +l+++n + ++ +gld++e++ + ++++f+++    g  ++ a +Y+G+QFG +++qLG+ Rg           
  VIMSS512376  11 TDNSFAALPAEFYTRLQPRPPAAPRLLHANAEAAALIGLDPAEFSTQAFLDVFSGHaplPGGDTL-AAVYSGHQFGVWAGQLGEVRGPAG-------- 99 
                  567889999***********************************************776677777.****************98887543........ PP

      UPF0061 102 elydfglKGsGlTPySRsaDGrlvLksgvREvlasealhklgvrtsralslietgekllRedePspersavvvRlarshiRfGtferlkylkrldllk 199
                    ++++lKG+G+TPySR++DGr+vL+s+vRE+lasea+h lg++t+r+l l+ +++ ++Re   + e++avv R+a+s++RfG+fe++ +++++++l+
  VIMSS512376 100 -GWELQLKGAGMTPYSRMGDGRAVLRSSVREYLASEAMHGLGIPTTRSLALVVSDDPVMRE---TVETAAVVTRMAPSFVRFGSFEHWSARRQPEQLR 193
                  .379*********************************************************...********************************** PP

      UPF0061 200 kLldyvieeyypel........adeeekyaqfyaelvervAelvAqWmaaGFchgVlNTDNmsilGeslDYGPyaFldkydpkftaayfDyagrYsya 289
                   L+dyvi+ +ype+          e+ ++  + a + +r+A l+A W+a+GFchgV+NTDNmsilG++lDYGPy+F+d+++  ++++++D++grY+++
  VIMSS512376 194 VLADYVIDRFYPECrvagagrlDGEHGEILGLLAAVTRRTALLMADWQAVGFCHGVMNTDNMSILGLTLDYGPYGFMDTFQLGHICNHSDSEGRYAWN 291
                  **************88887776666689999******************************************************************* PP

      UPF0061 290 nQpsiilwNLeqlaeplalli.eaeeleealeeykevyttkYaqlmlkkLGleklsekekefdselleellelLqetqvdYneffveLaeskskkwrd 386
                  +Qps+ lwNL +la++l++l  + e+l + l+ y+ v+t++++  m+ kLGl +   +    d++ll++ll+l++++ +d++  f++L e  + + + 
  VIMSS512376 292 RQPSVGLWNLYRLASSLHTLApDPEALRAVLDGYEAVFTQAFHGRMAGKLGLPQFLPE----DETLLDDLLQLMHQQGADFTLAFRRLGEAVRGQRQP 385
                  ********************74789***************************665433....447************************998888776 PP

      UPF0061 387 eaesileesekeleeekleeWrelYkklleeleedeleeraerlkkvNpktvllrplieeviekiaeeddlsplkklle 465
                   ++s+       ++++++ +W ++  ++ ++     +++ra+ +++vNp++vl++ l+e++i + a++ d  +++ ll+
  VIMSS512376 386 FEDSF-------IDRAAAGAWYDRLAARHASD-GRAAQARAAAMDEVNPLYVLRNHLAEQAIRA-AARGDAGEIDILLK 455
                  66665.......56788999*99998888754.558999************************9.88888877777665 PP



Or compare VIMSS512376 to CDD or PaperBLAST