PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS61470 to PF02696 (UPF0061)

VIMSS61470 has 486 amino acids

Query:       UPF0061  [M=468]
Accession:   PF02696.14
Description: Uncharacterized ACR, YdiU/UPF0061 family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
   4.8e-155  502.9   0.0   5.6e-155  502.6   0.0    1.0  1  VIMSS61470  


Domain annotation for each sequence (and alignments):
>> VIMSS61470  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  502.6   0.0  5.6e-155  5.6e-155       4     466 ..       6     455 ..       3     457 .. 0.95

  Alignments for each domain:
  == domain 1  score: 502.6 bits;  conditional E-value: 5.6e-155
     UPF0061   4 kleyepaleslgsdfydeveaaefpkkilrvrndalleelgldeeevkdeelieifgke...kgiepflalrYhGyQFGeynpqLGDGRgfllgqvrdk 99 
                  l++ +++++lg +f++ev +  + + +l+v++ a l+ l+l +e+ +++ ++e+fg++   ++ ep  a++Y+G+QFG+ynp+LGDGRg+llg+v ++
  VIMSS61470   6 DLDFDNRFARLGGAFSTEVLPDPIAEPRLVVASPAALALLDLPAETSDEALFAELFGGHklwSEAEPR-AMVYSGHQFGSYNPRLGDGRGLLLGEVINQ 103
                 5899***************************************9999999********9888899999.****************************** PP

     UPF0061 100 dgelydfglKGsGlTPySRsaDGrlvLksgvREvlasealhklgvrtsralslietgekllRedePspersavvvRlarshiRfGtferlkylkrldll 198
                  ge++d++lKG+G+TPySR++DGr+vL+s++RE+laseal +lg+++sral++i + + ++Re   ++e +a ++Rla+sh+RfG+fe ++y++++d+l
  VIMSS61470 104 AGEHWDLHLKGAGQTPYSRMGDGRAVLRSSIREFLASEALPALGIPSSRALCVIGSSTPVWRE---KKESAATLLRLAPSHVRFGHFEYFYYTRQHDQL 199
                 ***************************************************************...9******************************** PP

     UPF0061 199 kkLldyvieeyypeladeeekyaqfyaelvervAelvAqWmaaGFchgVlNTDNmsilGeslDYGPyaFldkydpkftaayfDyagrYsyanQpsiilw 297
                 k+L+ +v+e++++++++ e  ya++++++ver+Ael+A W+a+GFchgV+NTDNmsilG+++DYGPyaFld++d +++++++D agrYs++nQ  i++w
  VIMSS61470 200 KQLAAFVLEHHFADCNAAERPYAAMFRQVVERNAELIARWQAYGFCHGVMNTDNMSILGITFDYGPYAFLDDFDANHICNHSDDAGRYSFSNQVPIAHW 298
                 *************************************************************************************************** PP

     UPF0061 298 NLeqlaeplallieaeeleealeeykevyttkYaqlmlkkLGleklsekekefdselleellelLqetqvdYneffveLaeskskkwrdeaesileese 396
                 NL++la++l+ l+e +el ++l+ +   y+++Y +lm+++LGl      ++e+d++l++ell+ +q + vdY+ ff++L e++ +++  +   +    +
  VIMSS61470 299 NLAALAQALTPLVEVDELRASLDLFLPLYQAHYLDLMRRRLGL----GVAAENDHALVQELLQRMQGSAVDYSLFFRRLGEETPERALAS---L---RD 387
                 *******************************************....445555668***********************99977665422...2...23 PP

     UPF0061 397 keleeekleeWrelYkklleeleedeleeraerlkkvNpktvllrplieeviekiaeeddlsplkkllek 466
                 + +++e++++W e+Y++++ee+   ++e+r++r++ vNp++vl+++l++++ie+ ae+ d+++++ l++ 
  VIMSS61470 388 DFVDREAFDRWAEAYRRRVEEE-GGDQESRRRRMHAVNPLYVLRNYLAQQAIEA-AEQGDYTEVRLLHQV 455
                 447899**************65.6689999************************.999999999999876 PP



Or compare VIMSS61470 to CDD or PaperBLAST