PaperBLAST – Find papers about a protein or its homologs

 

Align WP_040818391.1 to PF02696 (UPF0061)

WP_040818391.1 has 471 amino acids

Query:       UPF0061  [M=468]
Accession:   PF02696.14
Description: Uncharacterized ACR, YdiU/UPF0061 family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
     3e-110  355.2   0.0   1.4e-108  349.6   0.0    2.0  1  WP_040818391.1  


Domain annotation for each sequence (and alignments):
>> WP_040818391.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  349.6   0.0  1.4e-108  1.4e-108       6     464 ..       5     438 ..       2     442 .. 0.90

  Alignments for each domain:
  == domain 1  score: 349.6 bits;  conditional E-value: 1.4e-108
         UPF0061   6 eyepaleslgsdfydeveaaefpkkilrvrndalleelgldeeevkdeelieifgke...kgiepflalrYhGyQFGeynpqLGDGRgfllgqvr 97 
                     e+ +++++l ++fy++++++ +    l++ ndal+ ++gld++ +++++ + +++++   +g ep+ a++Y+G+QFG + pqLGDGR+ +lg+v 
  WP_040818391.1   5 EFDNSYARLPERFYTKMNPTPVAAPALIALNDALAGDMGLDAAWLRSSDGLAMLAGNrmpDGAEPL-AQAYAGHQFGGWSPQLGDGRANVLGEVV 98 
                     57889999**********************************************999999999**9.**************************** PP

         UPF0061  98 dkdgelydfglKGsGlTPySRsaDGrlvLksgvREvlasealhklgvrtsralslietgekllRedePspersavvvRlarshiRfGtferlkyl 192
                     + dg  +d++lKGsG TPySR++DGr+ L   +RE++ sea+h+l v+t+ral  + tgek+ Re    ++++a++ R+a shiR+Gtf+ + ++
  WP_040818391.1  99 GPDGARWDIQLKGSGPTPYSRMGDGRAGLGPVMREYIFSEAMHALSVPTTRALAAVLTGEKVARE---VMQPGAILTRVAGSHIRVGTFQYFAAR 190
                     *****************************************************************...*************************** PP

         UPF0061 193 krldllkkLldyvieeyypeladeeekyaqfyaelvervAelvAqWmaaGFchgVlNTDNmsilGeslDYGPyaFldkydpkftaayfDyagrYs 287
                     ++ + l  Lld++i  +yp+l  e+     f + +   +A+lvA+Wm  GF+hgV+NTDN+ + G+++DYGP aF+d y+p+ +    D+ grY 
  WP_040818391.1 191 QDREALALLLDHAIGRHYPHL--EQGDGLGFLQAVTGAQASLVAEWMGLGFIHGVMNTDNTHVGGLTIDYGPCAFMDAYHPATVFSSIDQGGRYV 283
                     *******************99..6777899***************************************************************** PP

         UPF0061 288 yanQpsiilwNLeqlaeplalli......eaeeleealeeykevyttkYaqlmlkkLGleklsekekefdselleellelLqetqvdYneffveL 376
                     y+ Qp++  wNL+qla++l  +i      + ++  eal  + ++yt+++++++ +k+G  ++  +    +  l+++ll+ ++++q+d++++f+++
  WP_040818391.1 284 YQGQPEVLVWNLAQLASCLLPFIdadhdkAVTAAREALGAFGDHYTKSWKRVFFAKIGR-AMGGDD---QVVLVQDLLTRMADNQADFTRTFRAM 374
                     ***********************6666555556667777*******************9.333333...459*********************** PP

         UPF0061 377 aeskskkwrdeaesileesekeleeekleeWrelYkklleeleedeleeraerlkkvNpktvllrplieeviekiaeeddlsplkkll 464
                     a+ ++ + +     +       ++ +++++W + +               +++++ +Np++++++  +ee+i++   + d+ p+++l 
  WP_040818391.1 375 ARGEGARDE-----F-------VDPTSFDAWEAEWGGGD-----------ESIMRAANPAVIPRNHRVEEAIQA-GMQGDYAPFHRLN 438
                     988665422.....2.......34455667776665432...........356667777777777777777777.6677777777665 PP



Or compare WP_040818391.1 to CDD or PaperBLAST