PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::BanLI to PF03235 (DUF262)

REBASE::BanLI has 372 amino acids

Query:       DUF262  [M=221]
Accession:   PF03235.14
Description: Protein of unknown function DUF262
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    1.7e-21   63.5   0.9    2.5e-16   46.6   0.3    2.3  2  REBASE::BanLI  


Domain annotation for each sequence (and alignments):
>> REBASE::BanLI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   46.6   0.3   2.5e-16   2.5e-16      13      83 ..      34     103 ..      12     121 .. 0.78
   2 !   16.6   0.0   3.8e-07   3.8e-07     175     220 ..     115     158 ..      94     159 .. 0.77

  Alignments for each domain:
  == domain 1  score: 46.6 bits;  conditional E-value: 2.5e-16
         DUF262  13 riPdfQRpyvWeeeqveeLiedllalkgyplGsivlwskaadsageleviDGQQRltTltlllaat....keese 83 
                    + P +QR++v+++ +++  i+ +  l+g pl  ++    a+ +++++ev+DGQQR+ +l+ ++ ++     e+++
  REBASE::BanLI  34 IRPRYQREFVYKDAKRDAVIDTV--LQGLPLNVMYW---AKTGDDTYEVLDGQQRTISLMEYVDGNfsikYENNA 103
                    67*********************..***********...6777******************99993322222222 PP

  == domain 2  score: 16.6 bits;  conditional E-value: 3.8e-07
         DUF262 175 alktklslieieleseddedqayeiFerlNsrGvpLtasellkall 220
                     +  +++l++++++   ++++  + F+++N  G++Lt++el++a +
  REBASE::BanLI 115 ERILDYELLVYICD--GTDSEKLKWFKTINIAGERLTNQELRNAVY 158
                    34467888999999..67779**********************976 PP



Or compare REBASE::BanLI to CDD or PaperBLAST