PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS156538 to PF03235 (DUF262)

VIMSS156538 has 553 amino acids

Query:       DUF262  [M=221]
Accession:   PF03235.14
Description: Protein of unknown function DUF262
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    5.2e-40  124.1   9.3    5.2e-40  124.1   9.3    2.9  3  VIMSS156538  


Domain annotation for each sequence (and alignments):
>> VIMSS156538  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  124.1   9.3   5.2e-40   5.2e-40      11     221 .]      17     239 ..       3     239 .. 0.79
   2 ?   -1.1   0.2       0.1       0.1     131     166 ..     271     305 ..     245     367 .. 0.55
   3 ?   -2.6   4.2      0.27      0.27     109     187 ..     397     440 ..     341     543 .. 0.56

  Alignments for each domain:
  == domain 1  score: 124.1 bits;  conditional E-value: 5.2e-40
       DUF262  11 g..lriPdfQRpyvWeeeqveeLiedlla.....lkgyplGsivlwskaadsageleviDGQQRltTltlllaa..t..keesekriknleaeiekek 97 
                  +  ++iP++QR+y+Wee + e+L+ dl +      +++++G iv+   ++++++ +++iDGQQR++T +++laa  +   e +++ +++        +
  VIMSS156538  17 EniYKIPNYQREYSWEETELEDLWMDLSQiingeTESHFFGQIVI--HVDKKEKAKLIIDGQQRTSTAVIFLAAmrElfTEMYNAGWDD-------AQ 105
                  1349***********************99****99**********..677789*********************321233333333333.......44 PP

       DUF262  98 eeededrlkrreresdkellqkllrseklsleekeelaelnsltkkdlakeekrneeknlikayevieeilksa................llsalktk 179
                  ++++ + +k+  r++++ + +kl+ +e+++      +++++s + ++l  ++ ++++k+++ ay++++++l+++                ++s++ +k
  VIMSS156538 106 FDAQDITTKFIGRYTQTRDERKLILGENDKSY---FSNRIQSVSSEQLGLQKATKSQKRINFAYNYFYKKLEEEinssdfledkygllktFFSTFTEK 200
                  44444444444444444444444444444332...34566677777777788899999***********999999*99999999999999999999** PP

       DUF262 180 lslieieleseddedqayeiFerlNsrGvpLtasellkalll 221
                  +s++++e+++ ++   a++iFe+lN+rG+ L++++llk++l+
  VIMSS156538 201 CSVMFVETDDFNE---AFIIFETLNARGKDLETADLLKNHLF 239
                  ********99888...***********************997 PP

  == domain 2  score: -1.1 bits;  conditional E-value: 0.1
       DUF262 131 keelaelnsltkkdlakeekrneeknlikayeviee 166
                   +++++    ++kdl  +e r++  + ++a+ +i++
  VIMSS156538 271 HFWNSQNVFIREKDL-YKEIRKKITTQFEAIIFIDD 305
                  444444444444444.33345555555666666655 PP

  == domain 3  score: -2.6 bits;  conditional E-value: 0.27
       DUF262 109 eresdkellqkllrseklsleekeelaelnsltkkdlakeekrneeknlikayevieeilksa.....llsalktklslieiel 187
                  + +                                        +e +++ +++++i++ +  +     ++s++kt+ +l   ++
  VIMSS156538 397 IYQ----------------------------------------EEVESVTEIINLIRTNIIADdvflnNFSSFKTTNKLRLRYI 440
                  222........................................22222223333333222222332222222222222211111 PP



Or compare VIMSS156538 to CDD or PaperBLAST