PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS27031 to PF03235 (DUF262)

VIMSS27031 has 567 amino acids

Query:       DUF262  [M=221]
Accession:   PF03235.14
Description: Protein of unknown function DUF262
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
      8e-38  116.9   3.9      8e-38  116.9   3.9    2.9  2  VIMSS27031  


Domain annotation for each sequence (and alignments):
>> VIMSS27031  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  116.9   3.9     8e-38     8e-38       1     220 [.       5     213 ..       5     214 .. 0.76
   2 ?   -5.0   8.6         1         1     126     200 ..     289     371 ..     240     563 .. 0.71

  Alignments for each domain:
  == domain 1  score: 116.9 bits;  conditional E-value: 8e-38
      DUF262   1 ledllskskrglriPdfQRpyvWeeeqveeLiedlla.......lkgyplGsivlwskaadsageleviDGQQRltTltlllaatkeesekriknleae 92 
                 ++++++++   + iP++QR+y+W++++ ++L+edl++         g+++G++v+  k++d+++ +++iDGQQR+tT+++ll +      k+ ++ + e
  VIMSS27031   5 IKEIFQEEG--YSIPNYQRDYAWKDKNFRDLWEDLEEaieynkkGYGHFIGTMVV-AKNEDNKKLYDIIDGQQRTTTIFMLLHV---LVSKQYEEDKRE 97 
                 689999988..9***********************99*****9889*********.778888**********************...222222222333 PP

      DUF262  93 iekekeeededrlkrreresdkellqkllrseklslee.keelaelnsltkkdlakeekrneeknlikayevieeilksa....llsalktklslieie 186
                  +  k+ +++ +lk++   ++++++++ll+  +  +++                +k+  ++ ++nl+++++ i +++++     + + l+  l+++   
  VIMSS27031  98 TR--KYLYQKGELKLEVASQNQSFFKTLLEVAEKGNIShC--------------EKDADTEGKQNLFEVLKAILDKISKLseeeVNERLEVLLKMVLMR 180
                 33..344555566777777777777777777776666533..............344446777777777777777666665566444444456777788 PP

      DUF262 187 leseddedqayeiFerlNsrGvpLtasellkall 220
                 le+  d+ +a + F+++N+rGvpL   + lk+ll
  VIMSS27031 181 LEE-PDPGKAIRTFQSVNDRGVPLLLLDKLKSLL 213
                 875.89999**********************997 PP

  == domain 2  score: -5.0 bits;  conditional E-value: 1
      DUF262 126 lslee.keelaelnsltkkdlakeekrneeknlikayevieeilksa..................llsalktklslieieleseddedqayeiF 200
                 ++ e+ k el+e+++ + k + +   +++++ +++ ++++ e                       +        sli++ + + + +d+  ++F
  VIMSS27031 289 NTYEKlKAELKEIKKSKLKSFIQSYVSDLKNFYQAFLDLLSE----IdtnpttlkvmlinrinplF------FNSLIRLKINN-ELDDETLKLF 371
                 333332333333333333333222223333333333332222....02223433444322222211......22333333333.2224444444 PP



Or compare VIMSS27031 to CDD or PaperBLAST