PaperBLAST – Find papers about a protein or its homologs

 

Align WP_015644951.1 to PF03235 (DUF262)

WP_015644951.1 has 689 amino acids

Query:       DUF262  [M=221]
Accession:   PF03235.14
Description: Protein of unknown function DUF262
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    3.5e-41  127.9   4.8    3.5e-41  127.9   4.8    4.0  4  WP_015644951.1  


Domain annotation for each sequence (and alignments):
>> WP_015644951.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  127.9   4.8   3.5e-41   3.5e-41       7     220 ..      14     217 ..       6     218 .. 0.72
   2 ?    0.9   0.9     0.024     0.024     111     191 ..     224     307 ..     219     319 .. 0.58
   3 ?    0.1   0.8     0.043     0.043      86     166 ..     391     476 ..     367     526 .. 0.50
   4 ?   -0.3   4.2     0.054     0.054     112     192 ..     551     644 ..     516     650 .. 0.49

  Alignments for each domain:
  == domain 1  score: 127.9 bits;  conditional E-value: 3.5e-41
          DUF262   7 kskrg.lriPdfQRpyvWeeeqveeLiedlla......lkgyplGsivlw.skaadsageleviDGQQRltTltlllaa..t...keesekrikn 88 
                     ++ ++ l+iP++QR y+W +eq+++L++d+ +      + g+++Gsi+ + +k + s++ l++iDGQQRltT+tlll a  +   +e        
  WP_015644951.1  14 DNYKNqLVIPIYQRLYSWGKEQCKQLWDDIIKvggndkMDGHFIGSILYVlNKITHSNNALLIIDGQQRLTTITLLLTAlrNhlsDEV------- 101
                     3333359******************************99**********98888888**********************221222222....... PP

          DUF262  89 leaeiekekeeededrlkrr.eresdkellqkllrseklsleekeelaelnsltkkdlakeekrneeknlikayevieeilksa.....llsalk 177
                             k +e+ed++ ++  ++ dk++   l +s+k++l++++ + ++           + ++   ++ ++++++ee++++       ++ l 
  WP_015644951.1 102 --------KRKEIEDHYLINsDKDGDKKFRLILSESDKDTLLSLIDKDRR-----------KPSEPSLKIVENFKLFEEWVSNTdeletIFKGL- 176
                     ........233444444444233344444444444444444443322222...........226777788899999998888888655333333. PP

          DUF262 178 tklslieieleseddedqayeiFerlNsrGvpLtasellkall 220
                     +kl ++ei le+   +d+ + iFe++Ns+G++Lt+ +l+++++
  WP_015644951.1 177 EKLMIVEIALEK--GKDDPQLIFESMNSKGMELTQTDLIRNYI 217
                     888999999995..5679***********************87 PP

  == domain 2  score: 0.9 bits;  conditional E-value: 0.024
          DUF262 111 esdkellqkllrseklsleekeelaelnsltkkdlakeekrneeknlikayevieeilksa......llsal.ktklslieielesed 191
                     e+++ +++k++r  +++++++e+++++   ++ ++    k++e +n++k+y+ ++++ +++      ll+ l k+  ++++i++++e+
  WP_015644951.1 224 EKQEGFYNKYWRAMEEEFKQNEKWFDRFIRHYLTI----KTREIPNINKVYVALKDYRQKEgigiedLLKDLqKYCGYFCRIVFKKEA 307
                     55666677777777776666555554444444444....6888888888888888865555777666444442333344444444443 PP

  == domain 3  score: 0.1 bits;  conditional E-value: 0.043
          DUF262  86 iknleaeiek..........ekeeededrlkrreresdkellqkllrseklsleekeelaelnsltkkdl......akeekrneeknlikayevi 164
                     +k+lea++             +++   + +++ ++++++ ++++l + ++ ++ +       ++     l      +++ +++ ++ l ++++ i
  WP_015644951.1 391 FKSLEAHFGYltnnqrfpknDEFKDCFITIDFYKFKKNRYFFERLENFDTKEPVNT------KG-----LtvehimPQTLTEEWKRDLGENFQAI 474
                     44444444432222222211111111222222233344444444444443333331......12.....13333355555666666666666666 PP

          DUF262 165 ee 166
                     ++
  WP_015644951.1 475 HD 476
                     65 PP

  == domain 4  score: -0.3 bits;  conditional E-value: 0.054
          DUF262 112 sdkellqkllrseklslee.keelaelnsltkkdlakeekrneeknlikayevieeilksa...........llsalk.....tklslieieles 189
                      d e l+k+  +++ ++++ ++ ++ + s + ++l +   ++ ++   k++e +++++ s+           l    k      +l++ ++el++
  WP_015644951.1 551 LDAETLEKYKPKKDKKEKKvYDLSSYKFSSHSRELFDILSKEIKALDEKILEKFNKMCISYkfdtnfvsivpL----KngglnLYLNMPFYELQD 641
                     3333333333333333333333333333333344444444555555555555555555555655554433330....144444666777777776 PP

          DUF262 190 edd 192
                     e++
  WP_015644951.1 642 EKN 644
                     655 PP



Or compare WP_015644951.1 to CDD or PaperBLAST