A0M015 has 215 amino acids
Query: Gly_transporter [M=78] Accession: PF03458.17 Description: Glycine transporter Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-55 171.9 18.1 5.6e-30 89.4 3.2 2.3 2 A0M015 Domain annotation for each sequence (and alignments): >> A0M015 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 88.1 7.1 1.4e-29 1.4e-29 2 77 .. 11 85 .. 10 86 .. 0.96 2 ! 89.4 3.2 5.6e-30 5.6e-30 2 77 .. 97 170 .. 96 171 .. 0.96 Alignments for each domain: == domain 1 score: 88.1 bits; conditional E-value: 1.4e-29 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvlla 77 +ld++G++afa+sGal A++++ldlfg++++++vTa+gGG++RD+l+g e+Pv ++++++y++++ ++ +l+++++ A0M015 11 ILDVLGTIAFAISGALSAMNRRLDLFGIFIIAFVTAIGGGTVRDILIG-ETPVTWMENTVYVYLIGVVTILAIIFR 85 89**********************************************.7*******99***********999986 PP == domain 2 score: 89.4 bits; conditional E-value: 5.6e-30 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvlla 77 ++d+iGl++f+++G+ ++++++ld+++ v lG +T+++GGv+RD+l++ e+Pv++ +e +ya+a+l+gal++v l+ A0M015 97 LFDTIGLGVFTITGVETGIQNDLDPIISVALGAMTGTFGGVIRDILCN-EIPVIFRKE-IYATACLIGALAYVTLY 170 79**********************************************.7*****777.*************9986 PP
Or compare A0M015 to CDD or PaperBLAST