TCDB::A4WTL9 has 213 amino acids
Query: Gly_transporter [M=78] Accession: PF03458.17 Description: Glycine transporter Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-52 162.2 24.3 7.8e-31 92.1 7.6 2.2 2 TCDB::A4WTL9 Domain annotation for each sequence (and alignments): >> TCDB::A4WTL9 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.1 7.6 7.8e-31 7.8e-31 2 77 .. 8 82 .. 7 83 .. 0.97 2 ! 76.2 8.6 7.4e-26 7.4e-26 1 76 [. 93 166 .. 93 168 .. 0.96 Alignments for each domain: == domain 1 score: 92.1 bits; conditional E-value: 7.8e-31 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvlla 77 +ld +Gl++fa++Gal+A rk++d+ g+++lG+vT+vgGG++RD++lgr +Pv++++ep y+l++l +a+l++++a TCDB::A4WTL9 8 LLDWFGLGIFAMTGALVASRKEMDITGFALLGFVTGVGGGTIRDLVLGR-TPVFWVQEPAYVLVCLGVAVLTFFFA 82 79**********************************************5.************************97 PP == domain 2 score: 76.2 bits; conditional E-value: 7.4e-26 Gly_transporter 1 lvldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76 l+lda+Gl +fav+Ga Al++g ++++v++Gv+Ta++GG+lRD+l g e Pv+l re +y++aallga+++v+l TCDB::A4WTL9 93 LWLDAVGLSLFAVTGAERALEAGAGPVIAVTMGVATATFGGILRDLLGG-ESPVILRRE-IYITAALLGAATFVAL 166 59***********************************************.69****888.***********99976 PP
Or compare TCDB::A4WTL9 to CDD or PaperBLAST