VIMSS10159241 has 218 amino acids
Query: Gly_transporter [M=78] Accession: PF03458.17 Description: Glycine transporter Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-43 132.1 33.4 2.1e-24 71.5 13.5 2.3 2 VIMSS10159241 Domain annotation for each sequence (and alignments): >> VIMSS10159241 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 66.3 11.9 9e-23 9e-23 2 76 .. 23 95 .. 22 97 .. 0.91 2 ! 71.5 13.5 2.1e-24 2.1e-24 3 76 .. 112 183 .. 110 185 .. 0.93 Alignments for each domain: == domain 1 score: 66.3 bits; conditional E-value: 9e-23 Gly_transporter 2 vldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76 v++++Gl+afav+GalkA+++gld+fgv vlG+vTa+gGG+ RDvl++r P+ l + +++al+g++l+++l VIMSS10159241 23 VMNVVGLLAFAVAGALKAAEAGLDVFGVSVLGIVTALGGGTTRDVLVDR-LPASLAGT-WDMSVALVGVALAIVL 95 7899********************************************5.*****655.8899999999988876 PP == domain 2 score: 71.5 bits; conditional E-value: 2.1e-24 Gly_transporter 3 ldaiGlaafavsGalkAlrkgldlfgvvvlGvvTavgGGvlRDvllgrevPvvllreplyalaallgallvvll 76 da+Gl afa++Gal+++++g+ fgvv+l+++TavgGG + D+l+gr vPvvl ++ +ya++a++g+l+++++ VIMSS10159241 112 TDAVGLSAFAATGALVGVDAGVTSFGVVILATITAVGGGSIADILIGR-VPVVLRDD-FYATPAVVGGLAFLAA 183 79*********************************************5.*****656.***********99875 PP
Or compare VIMSS10159241 to CDD or PaperBLAST